Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074YS04

Protein Details
Accession A0A074YS04    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-125SPFGGGRPGRVRRKKAKAAESKEAGBasic
NLS Segment(s)
PositionSequence
106-119GRPGRVRRKKAKAA
Subcellular Location(s) cyto 18, nucl 6.5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022801  Ribosomal_S4/S9  
IPR005710  Ribosomal_S4/S9_euk/arc  
IPR018079  Ribosomal_S4_CS  
IPR002942  S4_RNA-bd  
IPR036986  S4_RNA-bd_sf  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01479  S4  
PROSITE View protein in PROSITE  
PS00632  RIBOSOMAL_S4  
PS50889  S4  
CDD cd00165  S4  
Amino Acid Sequences MDEKDPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDAQKHIDFALTSPFGGGRPGRVRRKKAKAAESKEAGGDEEEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.43
4 0.41
5 0.34
6 0.25
7 0.17
8 0.12
9 0.13
10 0.17
11 0.17
12 0.18
13 0.19
14 0.2
15 0.2
16 0.19
17 0.17
18 0.12
19 0.12
20 0.14
21 0.14
22 0.13
23 0.13
24 0.12
25 0.12
26 0.13
27 0.12
28 0.1
29 0.09
30 0.1
31 0.16
32 0.17
33 0.18
34 0.18
35 0.2
36 0.19
37 0.2
38 0.21
39 0.16
40 0.18
41 0.17
42 0.17
43 0.22
44 0.22
45 0.21
46 0.25
47 0.28
48 0.27
49 0.26
50 0.25
51 0.2
52 0.28
53 0.35
54 0.32
55 0.32
56 0.36
57 0.38
58 0.45
59 0.47
60 0.4
61 0.39
62 0.42
63 0.42
64 0.4
65 0.43
66 0.37
67 0.36
68 0.33
69 0.27
70 0.21
71 0.16
72 0.13
73 0.11
74 0.09
75 0.11
76 0.14
77 0.17
78 0.19
79 0.19
80 0.2
81 0.18
82 0.18
83 0.16
84 0.13
85 0.16
86 0.13
87 0.12
88 0.12
89 0.12
90 0.11
91 0.14
92 0.14
93 0.15
94 0.24
95 0.33
96 0.44
97 0.53
98 0.62
99 0.69
100 0.8
101 0.83
102 0.84
103 0.85
104 0.85
105 0.85
106 0.85
107 0.79
108 0.7
109 0.62
110 0.53
111 0.43
112 0.34
113 0.26