Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074YFF6

Protein Details
Accession A0A074YFF6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-68DSASPDGEPRRRRRRKQTIAVPDSEHydrophilic
NLS Segment(s)
PositionSequence
52-59PRRRRRRK
Subcellular Location(s) extr 17, mito 3, plas 3, golg 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MVAHLHPRSRSTMSLFSGCLAVCFAVVAAPHILPCPVDKTQVADSASPDGEPRRRRRRKQTIAVPDSEQQDDSDSTDTTRPKRECPVPKPSGLIGQAMGFKPQEPRQKPTIIIQTLRDRHASQDDQSSDKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.31
4 0.29
5 0.26
6 0.2
7 0.14
8 0.1
9 0.07
10 0.07
11 0.06
12 0.05
13 0.05
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.07
21 0.09
22 0.12
23 0.12
24 0.15
25 0.15
26 0.19
27 0.21
28 0.25
29 0.25
30 0.21
31 0.21
32 0.21
33 0.21
34 0.17
35 0.15
36 0.14
37 0.2
38 0.27
39 0.35
40 0.44
41 0.54
42 0.63
43 0.74
44 0.81
45 0.85
46 0.88
47 0.88
48 0.88
49 0.82
50 0.75
51 0.66
52 0.58
53 0.5
54 0.4
55 0.3
56 0.19
57 0.16
58 0.14
59 0.13
60 0.11
61 0.09
62 0.1
63 0.13
64 0.16
65 0.17
66 0.25
67 0.25
68 0.27
69 0.34
70 0.42
71 0.49
72 0.52
73 0.6
74 0.56
75 0.57
76 0.56
77 0.5
78 0.46
79 0.37
80 0.32
81 0.22
82 0.19
83 0.21
84 0.18
85 0.19
86 0.14
87 0.14
88 0.18
89 0.25
90 0.34
91 0.35
92 0.4
93 0.44
94 0.48
95 0.49
96 0.52
97 0.54
98 0.49
99 0.48
100 0.48
101 0.53
102 0.53
103 0.53
104 0.49
105 0.4
106 0.4
107 0.45
108 0.42
109 0.35
110 0.4
111 0.41
112 0.4