Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2WIY9

Protein Details
Accession A0A0A2WIY9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-66KAGQYAYRDRRQRKRQFRQLWIARIHydrophilic
NLS Segment(s)
PositionSequence
11-16AKRFKK
Subcellular Location(s) mito 12, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005813  Ribosomal_L20  
IPR037229  Ribosomal_L35_sf  
IPR035566  Ribosomal_protein_L20_C  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00453  Ribosomal_L20  
PROSITE View protein in PROSITE  
PS00937  RIBOSOMAL_L20  
CDD cd07026  Ribosomal_L20  
Amino Acid Sequences MPKIKTVRGAAKRFKKTASGGFKRYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.61
4 0.62
5 0.62
6 0.6
7 0.57
8 0.57
9 0.55
10 0.51
11 0.48
12 0.43
13 0.39
14 0.37
15 0.39
16 0.41
17 0.45
18 0.48
19 0.48
20 0.46
21 0.42
22 0.4
23 0.33
24 0.29
25 0.26
26 0.21
27 0.2
28 0.17
29 0.15
30 0.1
31 0.11
32 0.13
33 0.16
34 0.22
35 0.29
36 0.36
37 0.44
38 0.55
39 0.63
40 0.72
41 0.78
42 0.82
43 0.86
44 0.87
45 0.86
46 0.86
47 0.81
48 0.78
49 0.69
50 0.59
51 0.48
52 0.41
53 0.34
54 0.27
55 0.23
56 0.16
57 0.13
58 0.13
59 0.13
60 0.13
61 0.15
62 0.12
63 0.12
64 0.13
65 0.14
66 0.16
67 0.17
68 0.22
69 0.23
70 0.24
71 0.24
72 0.23
73 0.22
74 0.23
75 0.29
76 0.26
77 0.26
78 0.27
79 0.27
80 0.27
81 0.26
82 0.24
83 0.17
84 0.14
85 0.14
86 0.12
87 0.12
88 0.12
89 0.11
90 0.1
91 0.1
92 0.1
93 0.08
94 0.06
95 0.1
96 0.13
97 0.16
98 0.16
99 0.16