Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2W4S4

Protein Details
Accession A0A0A2W4S4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
126-146KIGVAKGKKQHDKRSDAKDREBasic
NLS Segment(s)
PositionSequence
131-140KGKKQHDKRS
Subcellular Location(s) mito 16.5, cyto_mito 12, cyto 6.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023620  SmpB  
IPR000037  SsrA-bd_prot  
IPR020081  SsrA-bd_prot_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF01668  SmpB  
PROSITE View protein in PROSITE  
PS01317  SSRP  
CDD cd09294  SmpB  
Amino Acid Sequences MTKKKAHKPGSATIALNKRARHEYFIEDEIEAGLALQGWEVKSLRAGKANIGDSYVIFKDGEAYLFGANFTPLTVASSHVVCDPTRTRKLLLTQRELDNLFGSVSRDGYTIVALSLYWKNAWCKVKIGVAKGKKQHDKRSDAKDREWAVDKARIMKNAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.55
4 0.48
5 0.45
6 0.48
7 0.48
8 0.45
9 0.41
10 0.39
11 0.4
12 0.41
13 0.37
14 0.29
15 0.27
16 0.22
17 0.19
18 0.13
19 0.08
20 0.05
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.07
27 0.08
28 0.08
29 0.12
30 0.15
31 0.17
32 0.21
33 0.21
34 0.22
35 0.27
36 0.3
37 0.25
38 0.24
39 0.22
40 0.17
41 0.2
42 0.17
43 0.12
44 0.1
45 0.09
46 0.1
47 0.1
48 0.1
49 0.07
50 0.08
51 0.07
52 0.07
53 0.08
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.08
66 0.08
67 0.09
68 0.08
69 0.12
70 0.14
71 0.2
72 0.24
73 0.24
74 0.25
75 0.26
76 0.34
77 0.39
78 0.42
79 0.41
80 0.42
81 0.42
82 0.44
83 0.42
84 0.35
85 0.27
86 0.21
87 0.15
88 0.11
89 0.11
90 0.08
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.06
98 0.06
99 0.05
100 0.05
101 0.08
102 0.08
103 0.09
104 0.1
105 0.12
106 0.14
107 0.22
108 0.26
109 0.25
110 0.27
111 0.29
112 0.35
113 0.37
114 0.41
115 0.43
116 0.47
117 0.53
118 0.57
119 0.64
120 0.67
121 0.72
122 0.76
123 0.76
124 0.77
125 0.78
126 0.81
127 0.83
128 0.79
129 0.74
130 0.73
131 0.67
132 0.64
133 0.61
134 0.53
135 0.47
136 0.48
137 0.46
138 0.45
139 0.47
140 0.44