Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2VRS4

Protein Details
Accession A0A0A2VRS4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-80LKKLSLAKKQAKKDAKTKRQQEKHAAEMDHydrophilic
NLS Segment(s)
PositionSequence
57-70LAKKQAKKDAKTKR
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR006224  PsdUridine_synth_RluA-like_CS  
IPR006225  PsdUridine_synth_RluC/D  
IPR006145  PsdUridine_synth_RsuA/RluA  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
Pfam View protein in Pfam  
PF00849  PseudoU_synth_2  
PROSITE View protein in PROSITE  
PS01129  PSI_RLU  
PS50889  S4  
CDD cd02557  PseudoU_synth_ScRIB2  
Amino Acid Sequences MLRRQLIRHIEPFTGANSTIKLRRQLARFSMTAPAATDRTESAVGAAAVEALKKLSLAKKQAKKDAKTKRQQEKHAAEMDAPPGPLITPAGDLWPRPYYFEDGLRRVKPYHFTYNTWCKERWRGRTLIDIFACEFRDRPLEYYRAAMELGDIFVNQRMVGPDYIVRNGDKISHTLHRHEPPVTAEPVGIIHEDDDMIVLNKPAGVPVHPAGRYNFNSVIEIMKSDRGKDFMPYPCNRLDRLTSGIMFIGKSPKAAVELGVKIQERSVRKEYLARVLGEFPDGEVVCDMPVLQISPKLGLNRVRANGKSARTVFKKLAYYPPRTPNLQSPDGQVTRKNTGYSIVRCLPVTGRTHQIRVHLQHLGYPIQNDPIYANQRVWGVNLGHDDAEAMRNTDEDIISRLSRMGKDEVAQAVVYYDEMVDEYEKKRAEKMTGELCDVCATPLYSDPGSHELSLWLHSLRYEDTDGAWSYKSPLPQWAMPPQGMEGPTTVGGMEELLKAVPETELQDGLATPEKDGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.26
3 0.21
4 0.2
5 0.24
6 0.27
7 0.31
8 0.36
9 0.39
10 0.46
11 0.5
12 0.56
13 0.58
14 0.58
15 0.54
16 0.49
17 0.5
18 0.43
19 0.39
20 0.32
21 0.28
22 0.23
23 0.23
24 0.22
25 0.16
26 0.18
27 0.18
28 0.16
29 0.13
30 0.15
31 0.14
32 0.12
33 0.12
34 0.09
35 0.09
36 0.09
37 0.08
38 0.06
39 0.06
40 0.06
41 0.11
42 0.17
43 0.24
44 0.34
45 0.44
46 0.52
47 0.6
48 0.7
49 0.76
50 0.77
51 0.8
52 0.81
53 0.82
54 0.84
55 0.86
56 0.87
57 0.87
58 0.89
59 0.89
60 0.85
61 0.82
62 0.77
63 0.68
64 0.58
65 0.52
66 0.45
67 0.37
68 0.29
69 0.21
70 0.15
71 0.14
72 0.13
73 0.11
74 0.09
75 0.08
76 0.09
77 0.13
78 0.14
79 0.14
80 0.18
81 0.22
82 0.21
83 0.22
84 0.24
85 0.26
86 0.27
87 0.35
88 0.38
89 0.4
90 0.47
91 0.46
92 0.47
93 0.44
94 0.45
95 0.44
96 0.44
97 0.48
98 0.45
99 0.46
100 0.52
101 0.61
102 0.63
103 0.6
104 0.55
105 0.5
106 0.56
107 0.62
108 0.62
109 0.58
110 0.56
111 0.54
112 0.62
113 0.61
114 0.58
115 0.49
116 0.41
117 0.36
118 0.34
119 0.33
120 0.23
121 0.21
122 0.14
123 0.19
124 0.18
125 0.2
126 0.23
127 0.24
128 0.24
129 0.26
130 0.25
131 0.21
132 0.2
133 0.16
134 0.12
135 0.1
136 0.1
137 0.08
138 0.07
139 0.06
140 0.07
141 0.08
142 0.07
143 0.07
144 0.08
145 0.1
146 0.1
147 0.11
148 0.13
149 0.15
150 0.16
151 0.17
152 0.16
153 0.14
154 0.15
155 0.17
156 0.15
157 0.14
158 0.17
159 0.23
160 0.25
161 0.29
162 0.36
163 0.37
164 0.39
165 0.38
166 0.36
167 0.33
168 0.34
169 0.31
170 0.24
171 0.2
172 0.17
173 0.16
174 0.15
175 0.11
176 0.07
177 0.06
178 0.06
179 0.06
180 0.05
181 0.05
182 0.04
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.06
191 0.06
192 0.09
193 0.11
194 0.16
195 0.16
196 0.18
197 0.19
198 0.25
199 0.26
200 0.27
201 0.27
202 0.22
203 0.23
204 0.22
205 0.21
206 0.15
207 0.14
208 0.11
209 0.14
210 0.13
211 0.14
212 0.14
213 0.15
214 0.15
215 0.16
216 0.21
217 0.22
218 0.29
219 0.29
220 0.31
221 0.35
222 0.36
223 0.35
224 0.32
225 0.28
226 0.24
227 0.26
228 0.24
229 0.19
230 0.18
231 0.17
232 0.15
233 0.13
234 0.11
235 0.11
236 0.1
237 0.1
238 0.09
239 0.09
240 0.1
241 0.1
242 0.11
243 0.1
244 0.11
245 0.12
246 0.15
247 0.14
248 0.13
249 0.14
250 0.17
251 0.16
252 0.21
253 0.25
254 0.23
255 0.24
256 0.29
257 0.29
258 0.32
259 0.33
260 0.28
261 0.25
262 0.24
263 0.24
264 0.19
265 0.17
266 0.1
267 0.1
268 0.09
269 0.08
270 0.07
271 0.07
272 0.06
273 0.06
274 0.06
275 0.03
276 0.03
277 0.04
278 0.04
279 0.05
280 0.05
281 0.07
282 0.09
283 0.1
284 0.13
285 0.19
286 0.23
287 0.26
288 0.29
289 0.32
290 0.31
291 0.35
292 0.37
293 0.33
294 0.35
295 0.33
296 0.37
297 0.36
298 0.4
299 0.38
300 0.37
301 0.38
302 0.34
303 0.42
304 0.41
305 0.45
306 0.48
307 0.53
308 0.52
309 0.51
310 0.51
311 0.48
312 0.49
313 0.46
314 0.4
315 0.35
316 0.39
317 0.4
318 0.39
319 0.34
320 0.31
321 0.32
322 0.33
323 0.3
324 0.23
325 0.25
326 0.3
327 0.29
328 0.31
329 0.29
330 0.29
331 0.28
332 0.29
333 0.26
334 0.25
335 0.27
336 0.23
337 0.28
338 0.29
339 0.32
340 0.33
341 0.37
342 0.38
343 0.38
344 0.39
345 0.34
346 0.32
347 0.32
348 0.33
349 0.3
350 0.24
351 0.22
352 0.18
353 0.19
354 0.19
355 0.16
356 0.15
357 0.19
358 0.23
359 0.22
360 0.22
361 0.2
362 0.22
363 0.22
364 0.22
365 0.2
366 0.16
367 0.17
368 0.19
369 0.18
370 0.16
371 0.15
372 0.15
373 0.11
374 0.13
375 0.11
376 0.1
377 0.09
378 0.09
379 0.1
380 0.11
381 0.1
382 0.08
383 0.11
384 0.12
385 0.13
386 0.13
387 0.15
388 0.16
389 0.17
390 0.2
391 0.2
392 0.19
393 0.2
394 0.24
395 0.23
396 0.21
397 0.2
398 0.16
399 0.13
400 0.12
401 0.1
402 0.07
403 0.05
404 0.04
405 0.05
406 0.05
407 0.07
408 0.1
409 0.11
410 0.16
411 0.19
412 0.2
413 0.24
414 0.26
415 0.29
416 0.31
417 0.36
418 0.4
419 0.4
420 0.43
421 0.39
422 0.36
423 0.33
424 0.29
425 0.22
426 0.15
427 0.13
428 0.11
429 0.13
430 0.16
431 0.15
432 0.15
433 0.18
434 0.21
435 0.22
436 0.22
437 0.2
438 0.18
439 0.18
440 0.2
441 0.18
442 0.15
443 0.13
444 0.13
445 0.15
446 0.14
447 0.16
448 0.17
449 0.16
450 0.16
451 0.2
452 0.21
453 0.21
454 0.2
455 0.17
456 0.19
457 0.22
458 0.24
459 0.22
460 0.27
461 0.31
462 0.35
463 0.4
464 0.44
465 0.46
466 0.43
467 0.42
468 0.37
469 0.36
470 0.32
471 0.27
472 0.2
473 0.18
474 0.17
475 0.16
476 0.14
477 0.1
478 0.09
479 0.09
480 0.1
481 0.08
482 0.08
483 0.08
484 0.08
485 0.08
486 0.08
487 0.08
488 0.08
489 0.11
490 0.13
491 0.13
492 0.13
493 0.14
494 0.13
495 0.16
496 0.21
497 0.19
498 0.17