Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EEN9

Protein Details
Accession A7EEN9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
132-151WEKKERRVKKCLKWLKKTGMBasic
NLS Segment(s)
PositionSequence
135-141KERRVKK
Subcellular Location(s) plas 14, mito 5, E.R. 4, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ssl:SS1G_03779  -  
Amino Acid Sequences MSSPNPTPSSSTPTSTTPVPTASTSLIRPPRYYMLTAFTNRLLPLALFTILLITGTVILIYTVVDKKVLPPRYIIASYITVAVIVGLWCSLRMILYLGREFGGIRTDEPERGLQMGMGLQGREGIDGINGLWEKKERRVKKCLKWLKKTGMLLGKFGARNHGNRNRNRDGTRSPASESDQNDIEIATSSTTSQALHHAIQTPQPAHQAIPLRDFAPLNPNSLAPIISPLQITVPSLSIPVNTHFRSSRSRSYPVDAGLGYLPQLHNAAVHVSSHKRTRVTRSRDVLSVRRPEPVTASEIVSCENLEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.35
4 0.29
5 0.28
6 0.26
7 0.24
8 0.24
9 0.24
10 0.25
11 0.23
12 0.3
13 0.35
14 0.36
15 0.36
16 0.38
17 0.41
18 0.42
19 0.43
20 0.36
21 0.33
22 0.37
23 0.38
24 0.36
25 0.32
26 0.3
27 0.28
28 0.26
29 0.21
30 0.15
31 0.14
32 0.13
33 0.12
34 0.09
35 0.09
36 0.09
37 0.08
38 0.08
39 0.06
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.04
48 0.07
49 0.08
50 0.08
51 0.09
52 0.09
53 0.16
54 0.24
55 0.29
56 0.27
57 0.28
58 0.3
59 0.35
60 0.36
61 0.31
62 0.25
63 0.22
64 0.22
65 0.2
66 0.17
67 0.12
68 0.1
69 0.09
70 0.06
71 0.05
72 0.04
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.06
81 0.08
82 0.11
83 0.11
84 0.12
85 0.12
86 0.12
87 0.12
88 0.11
89 0.12
90 0.09
91 0.09
92 0.11
93 0.12
94 0.13
95 0.15
96 0.15
97 0.13
98 0.13
99 0.13
100 0.1
101 0.09
102 0.09
103 0.09
104 0.08
105 0.07
106 0.06
107 0.08
108 0.08
109 0.07
110 0.07
111 0.05
112 0.04
113 0.05
114 0.05
115 0.06
116 0.06
117 0.06
118 0.07
119 0.1
120 0.12
121 0.2
122 0.29
123 0.35
124 0.41
125 0.52
126 0.61
127 0.67
128 0.76
129 0.78
130 0.79
131 0.8
132 0.82
133 0.78
134 0.75
135 0.67
136 0.61
137 0.58
138 0.48
139 0.4
140 0.33
141 0.29
142 0.24
143 0.23
144 0.23
145 0.18
146 0.2
147 0.28
148 0.36
149 0.41
150 0.45
151 0.54
152 0.54
153 0.58
154 0.58
155 0.54
156 0.48
157 0.48
158 0.47
159 0.4
160 0.36
161 0.32
162 0.33
163 0.33
164 0.31
165 0.26
166 0.22
167 0.2
168 0.19
169 0.16
170 0.14
171 0.09
172 0.08
173 0.06
174 0.05
175 0.05
176 0.06
177 0.06
178 0.06
179 0.06
180 0.09
181 0.11
182 0.12
183 0.13
184 0.15
185 0.16
186 0.18
187 0.21
188 0.19
189 0.18
190 0.2
191 0.19
192 0.17
193 0.2
194 0.25
195 0.23
196 0.25
197 0.25
198 0.23
199 0.24
200 0.24
201 0.21
202 0.22
203 0.21
204 0.21
205 0.2
206 0.2
207 0.19
208 0.19
209 0.19
210 0.1
211 0.13
212 0.11
213 0.11
214 0.11
215 0.1
216 0.11
217 0.11
218 0.12
219 0.09
220 0.09
221 0.08
222 0.09
223 0.09
224 0.09
225 0.11
226 0.13
227 0.19
228 0.19
229 0.23
230 0.24
231 0.27
232 0.34
233 0.39
234 0.45
235 0.45
236 0.5
237 0.5
238 0.54
239 0.54
240 0.48
241 0.44
242 0.34
243 0.3
244 0.24
245 0.21
246 0.15
247 0.14
248 0.13
249 0.11
250 0.12
251 0.1
252 0.1
253 0.1
254 0.12
255 0.1
256 0.11
257 0.15
258 0.19
259 0.24
260 0.3
261 0.34
262 0.38
263 0.42
264 0.52
265 0.58
266 0.62
267 0.67
268 0.68
269 0.68
270 0.68
271 0.69
272 0.67
273 0.65
274 0.66
275 0.57
276 0.57
277 0.54
278 0.49
279 0.47
280 0.42
281 0.38
282 0.3
283 0.31
284 0.26
285 0.25
286 0.25
287 0.21
288 0.18