Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VMY0

Protein Details
Accession A0A0A2VMY0    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-30APHPHCLLRFHIRRRYPRPRHITTSDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035935  TFB5-like_sf  
IPR009400  TFIIH_TTDA/Tfb5  
Gene Ontology GO:0000439  C:transcription factor TFIIH core complex  
GO:0005675  C:transcription factor TFIIH holo complex  
GO:0006289  P:nucleotide-excision repair  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF06331  Tfb5  
Amino Acid Sequences MLFSAPHPHCLLRFHIRRRYPRPRHITTSDLILQPLLPSAPSPLLPTLLTTTVFHSPPIIDSIQRQLVSPAPTRLALPRAGPSTAGFLFSFNPTAPSRSPDQGPYSNTPQTSVFQFNRWLTILALPGVLIECDPSIKSIIVNIDSENHDFIIEDLDEERVVVKENMVPLLKQKLEDRLKENLPPIDESGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.65
4 0.74
5 0.81
6 0.86
7 0.85
8 0.87
9 0.87
10 0.85
11 0.85
12 0.8
13 0.74
14 0.64
15 0.6
16 0.54
17 0.45
18 0.37
19 0.29
20 0.24
21 0.19
22 0.18
23 0.11
24 0.07
25 0.06
26 0.08
27 0.09
28 0.1
29 0.12
30 0.12
31 0.13
32 0.13
33 0.14
34 0.14
35 0.14
36 0.15
37 0.13
38 0.16
39 0.18
40 0.18
41 0.16
42 0.15
43 0.14
44 0.13
45 0.16
46 0.14
47 0.11
48 0.12
49 0.17
50 0.2
51 0.2
52 0.19
53 0.18
54 0.21
55 0.23
56 0.25
57 0.21
58 0.18
59 0.18
60 0.19
61 0.2
62 0.18
63 0.16
64 0.15
65 0.16
66 0.17
67 0.16
68 0.16
69 0.15
70 0.16
71 0.15
72 0.15
73 0.12
74 0.11
75 0.12
76 0.12
77 0.12
78 0.08
79 0.11
80 0.1
81 0.12
82 0.12
83 0.14
84 0.16
85 0.17
86 0.19
87 0.18
88 0.23
89 0.24
90 0.27
91 0.29
92 0.31
93 0.32
94 0.3
95 0.29
96 0.26
97 0.23
98 0.22
99 0.25
100 0.21
101 0.2
102 0.25
103 0.24
104 0.25
105 0.24
106 0.22
107 0.16
108 0.17
109 0.16
110 0.11
111 0.11
112 0.08
113 0.08
114 0.07
115 0.06
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.07
123 0.07
124 0.07
125 0.09
126 0.12
127 0.12
128 0.13
129 0.13
130 0.15
131 0.17
132 0.18
133 0.16
134 0.14
135 0.12
136 0.12
137 0.11
138 0.11
139 0.09
140 0.09
141 0.08
142 0.09
143 0.09
144 0.09
145 0.1
146 0.07
147 0.1
148 0.09
149 0.1
150 0.11
151 0.13
152 0.17
153 0.18
154 0.18
155 0.19
156 0.27
157 0.27
158 0.27
159 0.29
160 0.35
161 0.42
162 0.48
163 0.48
164 0.48
165 0.51
166 0.53
167 0.56
168 0.5
169 0.45
170 0.42
171 0.4