Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VQ51

Protein Details
Accession A0A0A2VQ51    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-143AIASCERIRRERRRRRGGGGLGBasic
NLS Segment(s)
PositionSequence
129-140IRRERRRRRGGG
Subcellular Location(s) plas 12, nucl 7, mito 5, cyto 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018253  DnaJ_domain_CS  
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
Amino Acid Sequences MHRSSSSSSGSIQDGATTTTTTTMSPQTRLHRYHLVVAAHQLLSNPAQRRRYDLYKMGWLAHTPPSATTQDPPPPSRAETWPPRTEDNDDDNDRPSPLKQVPIYMSNHAFAILVLVLAFGFAIASCERIRRERRRRRGGGGLGRLVDIVDGDIVRSLYGAQHLVSGRSKDERILAFLCRRHVTAMGGRQEVKDDEDDEDKKDEVEQHQGGFLPMDEHWEQNMCRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.12
5 0.11
6 0.11
7 0.12
8 0.11
9 0.13
10 0.18
11 0.2
12 0.24
13 0.29
14 0.36
15 0.43
16 0.46
17 0.5
18 0.5
19 0.5
20 0.53
21 0.52
22 0.46
23 0.39
24 0.38
25 0.36
26 0.28
27 0.26
28 0.2
29 0.16
30 0.16
31 0.22
32 0.25
33 0.28
34 0.34
35 0.34
36 0.4
37 0.46
38 0.5
39 0.51
40 0.51
41 0.49
42 0.51
43 0.52
44 0.47
45 0.4
46 0.34
47 0.3
48 0.28
49 0.25
50 0.18
51 0.17
52 0.19
53 0.2
54 0.2
55 0.2
56 0.21
57 0.26
58 0.3
59 0.31
60 0.3
61 0.3
62 0.31
63 0.33
64 0.32
65 0.33
66 0.39
67 0.44
68 0.46
69 0.47
70 0.47
71 0.46
72 0.45
73 0.42
74 0.37
75 0.36
76 0.34
77 0.32
78 0.32
79 0.3
80 0.26
81 0.22
82 0.18
83 0.17
84 0.16
85 0.2
86 0.18
87 0.21
88 0.22
89 0.26
90 0.28
91 0.25
92 0.25
93 0.21
94 0.2
95 0.17
96 0.15
97 0.1
98 0.08
99 0.05
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.03
110 0.03
111 0.05
112 0.06
113 0.08
114 0.1
115 0.17
116 0.27
117 0.36
118 0.48
119 0.57
120 0.68
121 0.77
122 0.81
123 0.8
124 0.8
125 0.78
126 0.75
127 0.7
128 0.61
129 0.51
130 0.45
131 0.39
132 0.3
133 0.2
134 0.12
135 0.06
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.06
146 0.07
147 0.06
148 0.1
149 0.1
150 0.13
151 0.16
152 0.16
153 0.17
154 0.2
155 0.21
156 0.19
157 0.23
158 0.21
159 0.23
160 0.23
161 0.26
162 0.28
163 0.31
164 0.34
165 0.32
166 0.31
167 0.29
168 0.29
169 0.28
170 0.29
171 0.34
172 0.35
173 0.36
174 0.36
175 0.35
176 0.36
177 0.33
178 0.28
179 0.23
180 0.19
181 0.19
182 0.24
183 0.25
184 0.25
185 0.27
186 0.24
187 0.22
188 0.23
189 0.25
190 0.21
191 0.29
192 0.28
193 0.26
194 0.28
195 0.28
196 0.26
197 0.22
198 0.19
199 0.13
200 0.11
201 0.16
202 0.16
203 0.17
204 0.18
205 0.21