Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EIN0

Protein Details
Accession A7EIN0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKKENKTKRESRVIKNEKKGVRBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
KEGG ssl:SS1G_05173  -  
Amino Acid Sequences MKKENKTKRESRVIKNEKKGVRHYSYFEYAVLKVSSTEKIEDQHCANKTTWTDNKYRGVSLPFHYYVGTPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.84
4 0.78
5 0.76
6 0.73
7 0.7
8 0.66
9 0.59
10 0.54
11 0.51
12 0.5
13 0.44
14 0.37
15 0.31
16 0.24
17 0.23
18 0.19
19 0.13
20 0.11
21 0.11
22 0.12
23 0.11
24 0.12
25 0.11
26 0.13
27 0.14
28 0.16
29 0.17
30 0.22
31 0.22
32 0.24
33 0.24
34 0.25
35 0.26
36 0.32
37 0.35
38 0.33
39 0.36
40 0.39
41 0.46
42 0.44
43 0.44
44 0.39
45 0.37
46 0.37
47 0.36
48 0.38
49 0.32
50 0.31
51 0.3