Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2VLW3

Protein Details
Accession A0A0A2VLW3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
141-164AKEIRVGHYKRPKRIKEKVESEAEBasic
NLS Segment(s)
PositionSequence
151-154RPKR
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003837  Asp/Glu-ADT_csu  
IPR036113  Asp/Glu-ADT_sf_sub_c  
Gene Ontology GO:0016740  F:transferase activity  
GO:0006450  P:regulation of translational fidelity  
Pfam View protein in Pfam  
PF02686  Glu-tRNAGln  
Amino Acid Sequences MSFSSSLCFRCRAVIHRPASQLLSQHRKAALSIKASTAHKILAQPTWSVRSLLAENDASPAETISSAQLHHLLKLCALPLPKSEEEEASMITTLQSQLHFVKAIQRVDTSGLEPLQAIRDETEEGRKEATIGLDDLKQVLAKEIRVGHYKRPKRIKEKVESEAENWDALSTASKKAGKYFVVESARKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.51
4 0.53
5 0.5
6 0.49
7 0.45
8 0.42
9 0.42
10 0.47
11 0.42
12 0.44
13 0.42
14 0.4
15 0.39
16 0.4
17 0.36
18 0.32
19 0.31
20 0.29
21 0.33
22 0.34
23 0.35
24 0.29
25 0.24
26 0.22
27 0.23
28 0.23
29 0.21
30 0.21
31 0.21
32 0.22
33 0.25
34 0.24
35 0.22
36 0.2
37 0.19
38 0.18
39 0.17
40 0.18
41 0.14
42 0.14
43 0.14
44 0.14
45 0.11
46 0.1
47 0.09
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.06
54 0.07
55 0.12
56 0.12
57 0.13
58 0.15
59 0.14
60 0.14
61 0.14
62 0.14
63 0.12
64 0.12
65 0.11
66 0.11
67 0.17
68 0.17
69 0.18
70 0.18
71 0.17
72 0.17
73 0.17
74 0.15
75 0.1
76 0.09
77 0.07
78 0.06
79 0.06
80 0.05
81 0.06
82 0.05
83 0.07
84 0.07
85 0.08
86 0.08
87 0.08
88 0.15
89 0.19
90 0.2
91 0.19
92 0.19
93 0.19
94 0.21
95 0.21
96 0.15
97 0.12
98 0.11
99 0.1
100 0.1
101 0.09
102 0.09
103 0.09
104 0.08
105 0.07
106 0.08
107 0.09
108 0.1
109 0.16
110 0.16
111 0.16
112 0.17
113 0.16
114 0.16
115 0.15
116 0.15
117 0.1
118 0.09
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.08
126 0.12
127 0.12
128 0.11
129 0.15
130 0.18
131 0.21
132 0.28
133 0.3
134 0.36
135 0.45
136 0.52
137 0.58
138 0.66
139 0.72
140 0.75
141 0.83
142 0.83
143 0.83
144 0.84
145 0.82
146 0.8
147 0.73
148 0.64
149 0.6
150 0.51
151 0.4
152 0.32
153 0.24
154 0.16
155 0.13
156 0.17
157 0.13
158 0.14
159 0.21
160 0.23
161 0.24
162 0.29
163 0.35
164 0.31
165 0.34
166 0.34
167 0.37
168 0.43