Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2W6C5

Protein Details
Accession A0A0A2W6C5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-32EFVRLFRRKNKLQREIQDVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007458  DUF496  
Pfam View protein in Pfam  
PF04363  DUF496  
Amino Acid Sequences MENIKPTFQDVLEFVRLFRRKNKLQREIQDVEKKIRDNQKRVLLLDNLSDYIKPGMSIEAVQGIIASMKTDYEDRVDDYIIKNAELSKERREISKKLKVMGEQKVADTKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.3
3 0.32
4 0.33
5 0.39
6 0.43
7 0.48
8 0.58
9 0.68
10 0.69
11 0.75
12 0.79
13 0.8
14 0.75
15 0.74
16 0.73
17 0.64
18 0.6
19 0.55
20 0.49
21 0.47
22 0.53
23 0.52
24 0.49
25 0.54
26 0.57
27 0.57
28 0.56
29 0.53
30 0.45
31 0.38
32 0.33
33 0.26
34 0.19
35 0.15
36 0.14
37 0.11
38 0.09
39 0.08
40 0.07
41 0.06
42 0.05
43 0.05
44 0.06
45 0.05
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.03
55 0.03
56 0.05
57 0.05
58 0.06
59 0.08
60 0.09
61 0.11
62 0.12
63 0.12
64 0.13
65 0.14
66 0.18
67 0.16
68 0.15
69 0.14
70 0.14
71 0.18
72 0.22
73 0.24
74 0.25
75 0.31
76 0.32
77 0.39
78 0.43
79 0.47
80 0.52
81 0.59
82 0.56
83 0.56
84 0.59
85 0.59
86 0.62
87 0.62
88 0.6
89 0.52
90 0.51
91 0.53