Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VT39

Protein Details
Accession A0A0A2VT39    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-47KIDLGSPKPHQPKPKRIASVSHydrophilic
NLS Segment(s)
PositionSequence
566-576RPLEKEGKRKG
Subcellular Location(s) nucl 15, mito_nucl 11.333, cyto_nucl 10.333, mito 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR030379  G_SEPTIN_dom  
IPR027417  P-loop_NTPase  
IPR016491  Septin  
Gene Ontology GO:0005619  C:ascospore wall  
GO:1990317  C:Gin4 complex  
GO:0001400  C:mating projection base  
GO:0005628  C:prospore membrane  
GO:0031105  C:septin complex  
GO:0032160  C:septin filament array  
GO:0005525  F:GTP binding  
GO:0070273  F:phosphatidylinositol-4-phosphate binding  
GO:0010314  F:phosphatidylinositol-5-phosphate binding  
GO:0005200  F:structural constituent of cytoskeleton  
GO:0000281  P:mitotic cytokinesis  
GO:0071902  P:positive regulation of protein serine/threonine kinase activity  
GO:0000921  P:septin ring assembly  
GO:0031107  P:septin ring disassembly  
Pfam View protein in Pfam  
PF00735  Septin  
PROSITE View protein in PROSITE  
PS51719  G_SEPTIN  
CDD cd01850  CDC_Septin  
Amino Acid Sequences MPFDFVQQVRSRTRSLQLDQASLAAAKIDLGSPKPHQPKPKRIASVSAASGRPSSLVAVAPNAAQPYRSMLDVDEPPKLPLKSMSFSELYSGSMDSIRFDSDGGSSDFAEAATSASTIQKQGSGTPISTNGTASPPTMAPASPANGKLDIPADFGKGVIPSNPVSVDVSASAVQDTRNIVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTLVNTLFNTSLYPPKERKGPSLDIIPKTVTIQSISADIEEAGVRLRLTVVDTPGFGDFVNNDESWRPITDNIEQRYDAYLDAENKVNRMNIVDNRIHACVFFIQPTGHSLKPLDIEVMRRLHTKVNLIPVIAKSDTLTDEEIASFKARILSDIRHHGIQIFEGPRYELDDEETIAENNEIMSKVPFAVVGATNEIKTPDGRAVRGRQYPWGTIEVDNEEHCDFVKLRQMLIRTHMEELKEHTNNTLYENYRTDKLIAMGVSQDPSVFKEVNPAVKQEEERALHEQKLAKMEAEMKMVFQQKVQEKESKLKQSEEELYARHREMKEQLDRQRLELEDKKQRVESGRPLEKEGKRKGFSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.54
4 0.5
5 0.5
6 0.46
7 0.42
8 0.35
9 0.27
10 0.23
11 0.14
12 0.1
13 0.08
14 0.08
15 0.09
16 0.11
17 0.13
18 0.18
19 0.22
20 0.32
21 0.41
22 0.47
23 0.56
24 0.63
25 0.72
26 0.76
27 0.82
28 0.81
29 0.75
30 0.76
31 0.7
32 0.67
33 0.61
34 0.58
35 0.49
36 0.42
37 0.4
38 0.32
39 0.27
40 0.2
41 0.16
42 0.12
43 0.12
44 0.12
45 0.13
46 0.13
47 0.13
48 0.14
49 0.15
50 0.14
51 0.12
52 0.12
53 0.16
54 0.17
55 0.17
56 0.16
57 0.15
58 0.2
59 0.26
60 0.28
61 0.27
62 0.27
63 0.28
64 0.33
65 0.33
66 0.28
67 0.28
68 0.32
69 0.3
70 0.31
71 0.34
72 0.3
73 0.3
74 0.31
75 0.25
76 0.2
77 0.18
78 0.16
79 0.12
80 0.12
81 0.12
82 0.12
83 0.12
84 0.12
85 0.11
86 0.11
87 0.11
88 0.1
89 0.12
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.11
96 0.1
97 0.08
98 0.07
99 0.06
100 0.06
101 0.06
102 0.08
103 0.09
104 0.1
105 0.1
106 0.12
107 0.12
108 0.14
109 0.18
110 0.18
111 0.18
112 0.19
113 0.21
114 0.2
115 0.2
116 0.19
117 0.16
118 0.16
119 0.15
120 0.14
121 0.14
122 0.12
123 0.13
124 0.13
125 0.11
126 0.11
127 0.13
128 0.15
129 0.16
130 0.17
131 0.18
132 0.18
133 0.18
134 0.18
135 0.18
136 0.16
137 0.16
138 0.15
139 0.15
140 0.13
141 0.13
142 0.13
143 0.12
144 0.11
145 0.1
146 0.11
147 0.11
148 0.12
149 0.12
150 0.12
151 0.13
152 0.12
153 0.12
154 0.09
155 0.1
156 0.1
157 0.1
158 0.09
159 0.08
160 0.08
161 0.1
162 0.11
163 0.14
164 0.21
165 0.23
166 0.24
167 0.29
168 0.31
169 0.33
170 0.34
171 0.35
172 0.29
173 0.31
174 0.32
175 0.29
176 0.27
177 0.24
178 0.22
179 0.19
180 0.18
181 0.19
182 0.21
183 0.21
184 0.26
185 0.29
186 0.38
187 0.46
188 0.54
189 0.59
190 0.62
191 0.67
192 0.64
193 0.7
194 0.61
195 0.52
196 0.44
197 0.34
198 0.27
199 0.21
200 0.18
201 0.09
202 0.07
203 0.07
204 0.05
205 0.05
206 0.04
207 0.04
208 0.05
209 0.08
210 0.09
211 0.1
212 0.1
213 0.13
214 0.13
215 0.13
216 0.13
217 0.11
218 0.16
219 0.17
220 0.21
221 0.21
222 0.23
223 0.3
224 0.31
225 0.35
226 0.36
227 0.38
228 0.36
229 0.43
230 0.47
231 0.41
232 0.41
233 0.36
234 0.29
235 0.27
236 0.25
237 0.16
238 0.11
239 0.1
240 0.09
241 0.1
242 0.09
243 0.08
244 0.08
245 0.07
246 0.06
247 0.06
248 0.05
249 0.04
250 0.05
251 0.05
252 0.04
253 0.05
254 0.04
255 0.06
256 0.07
257 0.08
258 0.08
259 0.09
260 0.1
261 0.1
262 0.1
263 0.08
264 0.07
265 0.05
266 0.06
267 0.09
268 0.08
269 0.08
270 0.08
271 0.09
272 0.1
273 0.11
274 0.1
275 0.08
276 0.11
277 0.16
278 0.23
279 0.25
280 0.26
281 0.25
282 0.25
283 0.25
284 0.23
285 0.17
286 0.12
287 0.12
288 0.11
289 0.12
290 0.15
291 0.14
292 0.14
293 0.15
294 0.14
295 0.12
296 0.12
297 0.14
298 0.14
299 0.19
300 0.2
301 0.2
302 0.22
303 0.22
304 0.21
305 0.17
306 0.15
307 0.11
308 0.11
309 0.1
310 0.09
311 0.08
312 0.09
313 0.12
314 0.15
315 0.13
316 0.14
317 0.13
318 0.14
319 0.15
320 0.15
321 0.14
322 0.11
323 0.13
324 0.16
325 0.18
326 0.18
327 0.19
328 0.2
329 0.21
330 0.22
331 0.24
332 0.23
333 0.27
334 0.27
335 0.25
336 0.26
337 0.23
338 0.24
339 0.2
340 0.18
341 0.11
342 0.12
343 0.12
344 0.12
345 0.12
346 0.09
347 0.09
348 0.09
349 0.09
350 0.09
351 0.09
352 0.07
353 0.07
354 0.11
355 0.1
356 0.12
357 0.14
358 0.17
359 0.21
360 0.28
361 0.29
362 0.26
363 0.26
364 0.26
365 0.23
366 0.2
367 0.21
368 0.16
369 0.15
370 0.15
371 0.15
372 0.14
373 0.17
374 0.17
375 0.11
376 0.12
377 0.12
378 0.12
379 0.13
380 0.14
381 0.11
382 0.1
383 0.1
384 0.07
385 0.07
386 0.08
387 0.06
388 0.06
389 0.07
390 0.07
391 0.07
392 0.07
393 0.07
394 0.06
395 0.08
396 0.08
397 0.09
398 0.12
399 0.12
400 0.12
401 0.13
402 0.13
403 0.12
404 0.11
405 0.12
406 0.15
407 0.17
408 0.19
409 0.24
410 0.3
411 0.36
412 0.42
413 0.42
414 0.43
415 0.44
416 0.45
417 0.42
418 0.39
419 0.33
420 0.29
421 0.3
422 0.25
423 0.23
424 0.21
425 0.21
426 0.18
427 0.15
428 0.15
429 0.15
430 0.12
431 0.13
432 0.21
433 0.19
434 0.2
435 0.23
436 0.26
437 0.25
438 0.3
439 0.34
440 0.28
441 0.31
442 0.32
443 0.3
444 0.29
445 0.32
446 0.35
447 0.31
448 0.29
449 0.27
450 0.28
451 0.28
452 0.3
453 0.32
454 0.25
455 0.27
456 0.31
457 0.32
458 0.3
459 0.31
460 0.28
461 0.24
462 0.22
463 0.21
464 0.18
465 0.16
466 0.16
467 0.16
468 0.16
469 0.14
470 0.13
471 0.1
472 0.12
473 0.15
474 0.14
475 0.12
476 0.2
477 0.24
478 0.32
479 0.33
480 0.33
481 0.32
482 0.36
483 0.37
484 0.33
485 0.38
486 0.31
487 0.34
488 0.38
489 0.39
490 0.36
491 0.4
492 0.4
493 0.35
494 0.38
495 0.35
496 0.29
497 0.28
498 0.32
499 0.3
500 0.3
501 0.26
502 0.22
503 0.27
504 0.32
505 0.3
506 0.27
507 0.32
508 0.35
509 0.42
510 0.45
511 0.47
512 0.45
513 0.55
514 0.62
515 0.64
516 0.61
517 0.58
518 0.56
519 0.56
520 0.59
521 0.54
522 0.48
523 0.41
524 0.43
525 0.43
526 0.42
527 0.42
528 0.36
529 0.37
530 0.4
531 0.47
532 0.52
533 0.56
534 0.63
535 0.66
536 0.66
537 0.63
538 0.63
539 0.55
540 0.54
541 0.52
542 0.53
543 0.53
544 0.56
545 0.58
546 0.54
547 0.57
548 0.55
549 0.55
550 0.57
551 0.57
552 0.62
553 0.6
554 0.64
555 0.69
556 0.69
557 0.71
558 0.71
559 0.71
560 0.64