FuNGI

A0A0A2VT39

Protein Details

Accession

A0A0A2VT39

Localization Confidence

Medium

Confidence Score

11.1

NoLS Segment(s)

Position	Sequence	Protein Nature
27-47	KIDLGSPKPHQPKPKRIASVS	Hydrophilic

NLS Segment(s)

Position	Sequence
566-576	RPLEKEGKRKG

Subcellular Location(s)

nucl 15, mito_nucl 11.333, cyto_nucl 10.333, mito 6.5, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR030379 G_SEPTIN_dom IPR027417 P-loop_NTPase IPR016491 Septin
Gene Ontology	GO:0005619 C:ascospore wall GO:1990317 C:Gin4 complex GO:0001400 C:mating projection base GO:0005628 C:prospore membrane GO:0031105 C:septin complex GO:0032160 C:septin filament array GO:0005525 F:GTP binding GO:0070273 F:phosphatidylinositol-4-phosphate binding GO:0010314 F:phosphatidylinositol-5-phosphate binding GO:0005200 F:structural constituent of cytoskeleton GO:0000281 P:mitotic cytokinesis GO:0071902 P:positive regulation of protein serine/threonine kinase activity GO:0000921 P:septin ring assembly GO:0031107 P:septin ring disassembly
Pfam	View protein in Pfam PF00735 Septin
PROSITE	View protein in PROSITE PS51719 G_SEPTIN
CDD	cd01850 CDC_Septin

Amino Acid Sequences

MPFDFVQQVRSRTRSLQLDQASLAAAKIDLGSPKPHQPKPKRIASVSAASGRPSSLVAVAPNAAQPYRSMLDVDEPPKLPLKSMSFSELYSGSMDSIRFDSDGGSSDFAEAATSASTIQKQGSGTPISTNGTASPPTMAPASPANGKLDIPADFGKGVIPSNPVSVDVSASAVQDTRNIVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTLVNTLFNTSLYPPKERKGPSLDIIPKTVTIQSISADIEEAGVRLRLTVVDTPGFGDFVNNDESWRPITDNIEQRYDAYLDAENKVNRMNIVDNRIHACVFFIQPTGHSLKPLDIEVMRRLHTKVNLIPVIAKSDTLTDEEIASFKARILSDIRHHGIQIFEGPRYELDDEETIAENNEIMSKVPFAVVGATNEIKTPDGRAVRGRQYPWGTIEVDNEEHCDFVKLRQMLIRTHMEELKEHTNNTLYENYRTDKLIAMGVSQDPSVFKEVNPAVKQEEERALHEQKLAKMEAEMKMVFQQKVQEKESKLKQSEEELYARHREMKEQLDRQRLELEDKKQRVESGRPLEKEGKRKGFSLR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.52
2	0.5
3	0.54
4	0.5
5	0.5
6	0.46
7	0.42
8	0.35
9	0.27
10	0.23
11	0.14
12	0.1
13	0.08
14	0.08
15	0.09
16	0.11
17	0.13
18	0.18
19	0.22
20	0.32
21	0.41
22	0.47
23	0.56
24	0.63
25	0.72
26	0.76
27	0.82
28	0.81
29	0.75
30	0.76
31	0.7
32	0.67
33	0.61
34	0.58
35	0.49
36	0.42
37	0.4
38	0.32
39	0.27
40	0.2
41	0.16
42	0.12
43	0.12
44	0.12
45	0.13
46	0.13
47	0.13
48	0.14
49	0.15
50	0.14
51	0.12
52	0.12
53	0.16
54	0.17
55	0.17
56	0.16
57	0.15
58	0.2
59	0.26
60	0.28
61	0.27
62	0.27
63	0.28
64	0.33
65	0.33
66	0.28
67	0.28
68	0.32
69	0.3
70	0.31
71	0.34
72	0.3
73	0.3
74	0.31
75	0.25
76	0.2
77	0.18
78	0.16
79	0.12
80	0.12
81	0.12
82	0.12
83	0.12
84	0.12
85	0.11
86	0.11
87	0.11
88	0.1
89	0.12
90	0.12
91	0.12
92	0.12
93	0.12
94	0.12
95	0.11
96	0.1
97	0.08
98	0.07
99	0.06
100	0.06
101	0.06
102	0.08
103	0.09
104	0.1
105	0.1
106	0.12
107	0.12
108	0.14
109	0.18
110	0.18
111	0.18
112	0.19
113	0.21
114	0.2
115	0.2
116	0.19
117	0.16
118	0.16
119	0.15
120	0.14
121	0.14
122	0.12
123	0.13
124	0.13
125	0.11
126	0.11
127	0.13
128	0.15
129	0.16
130	0.17
131	0.18
132	0.18
133	0.18
134	0.18
135	0.18
136	0.16
137	0.16
138	0.15
139	0.15
140	0.13
141	0.13
142	0.13
143	0.12
144	0.11
145	0.1
146	0.11
147	0.11
148	0.12
149	0.12
150	0.12
151	0.13
152	0.12
153	0.12
154	0.09
155	0.1
156	0.1
157	0.1
158	0.09
159	0.08
160	0.08
161	0.1
162	0.11
163	0.14
164	0.21
165	0.23
166	0.24
167	0.29
168	0.31
169	0.33
170	0.34
171	0.35
172	0.29
173	0.31
174	0.32
175	0.29
176	0.27
177	0.24
178	0.22
179	0.19
180	0.18
181	0.19
182	0.21
183	0.21
184	0.26
185	0.29
186	0.38
187	0.46
188	0.54
189	0.59
190	0.62
191	0.67
192	0.64
193	0.7
194	0.61
195	0.52
196	0.44
197	0.34
198	0.27
199	0.21
200	0.18
201	0.09
202	0.07
203	0.07
204	0.05
205	0.05
206	0.04
207	0.04
208	0.05
209	0.08
210	0.09
211	0.1
212	0.1
213	0.13
214	0.13
215	0.13
216	0.13
217	0.11
218	0.16
219	0.17
220	0.21
221	0.21
222	0.23
223	0.3
224	0.31
225	0.35
226	0.36
227	0.38
228	0.36
229	0.43
230	0.47
231	0.41
232	0.41
233	0.36
234	0.29
235	0.27
236	0.25
237	0.16
238	0.11
239	0.1
240	0.09
241	0.1
242	0.09
243	0.08
244	0.08
245	0.07
246	0.06
247	0.06
248	0.05
249	0.04
250	0.05
251	0.05
252	0.04
253	0.05
254	0.04
255	0.06
256	0.07
257	0.08
258	0.08
259	0.09
260	0.1
261	0.1
262	0.1
263	0.08
264	0.07
265	0.05
266	0.06
267	0.09
268	0.08
269	0.08
270	0.08
271	0.09
272	0.1
273	0.11
274	0.1
275	0.08
276	0.11
277	0.16
278	0.23
279	0.25
280	0.26
281	0.25
282	0.25
283	0.25
284	0.23
285	0.17
286	0.12
287	0.12
288	0.11
289	0.12
290	0.15
291	0.14
292	0.14
293	0.15
294	0.14
295	0.12
296	0.12
297	0.14
298	0.14
299	0.19
300	0.2
301	0.2
302	0.22
303	0.22
304	0.21
305	0.17
306	0.15
307	0.11
308	0.11
309	0.1
310	0.09
311	0.08
312	0.09
313	0.12
314	0.15
315	0.13
316	0.14
317	0.13
318	0.14
319	0.15
320	0.15
321	0.14
322	0.11
323	0.13
324	0.16
325	0.18
326	0.18
327	0.19
328	0.2
329	0.21
330	0.22
331	0.24
332	0.23
333	0.27
334	0.27
335	0.25
336	0.26
337	0.23
338	0.24
339	0.2
340	0.18
341	0.11
342	0.12
343	0.12
344	0.12
345	0.12
346	0.09
347	0.09
348	0.09
349	0.09
350	0.09
351	0.09
352	0.07
353	0.07
354	0.11
355	0.1
356	0.12
357	0.14
358	0.17
359	0.21
360	0.28
361	0.29
362	0.26
363	0.26
364	0.26
365	0.23
366	0.2
367	0.21
368	0.16
369	0.15
370	0.15
371	0.15
372	0.14
373	0.17
374	0.17
375	0.11
376	0.12
377	0.12
378	0.12
379	0.13
380	0.14
381	0.11
382	0.1
383	0.1
384	0.07
385	0.07
386	0.08
387	0.06
388	0.06
389	0.07
390	0.07
391	0.07
392	0.07
393	0.07
394	0.06
395	0.08
396	0.08
397	0.09
398	0.12
399	0.12
400	0.12
401	0.13
402	0.13
403	0.12
404	0.11
405	0.12
406	0.15
407	0.17
408	0.19
409	0.24
410	0.3
411	0.36
412	0.42
413	0.42
414	0.43
415	0.44
416	0.45
417	0.42
418	0.39
419	0.33
420	0.29
421	0.3
422	0.25
423	0.23
424	0.21
425	0.21
426	0.18
427	0.15
428	0.15
429	0.15
430	0.12
431	0.13
432	0.21
433	0.19
434	0.2
435	0.23
436	0.26
437	0.25
438	0.3
439	0.34
440	0.28
441	0.31
442	0.32
443	0.3
444	0.29
445	0.32
446	0.35
447	0.31
448	0.29
449	0.27
450	0.28
451	0.28
452	0.3
453	0.32
454	0.25
455	0.27
456	0.31
457	0.32
458	0.3
459	0.31
460	0.28
461	0.24
462	0.22
463	0.21
464	0.18
465	0.16
466	0.16
467	0.16
468	0.16
469	0.14
470	0.13
471	0.1
472	0.12
473	0.15
474	0.14
475	0.12
476	0.2
477	0.24
478	0.32
479	0.33
480	0.33
481	0.32
482	0.36
483	0.37
484	0.33
485	0.38
486	0.31
487	0.34
488	0.38
489	0.39
490	0.36
491	0.4
492	0.4
493	0.35
494	0.38
495	0.35
496	0.29
497	0.28
498	0.32
499	0.3
500	0.3
501	0.26
502	0.22
503	0.27
504	0.32
505	0.3
506	0.27
507	0.32
508	0.35
509	0.42
510	0.45
511	0.47
512	0.45
513	0.55
514	0.62
515	0.64
516	0.61
517	0.58
518	0.56
519	0.56
520	0.59
521	0.54
522	0.48
523	0.41
524	0.43
525	0.43
526	0.42
527	0.42
528	0.36
529	0.37
530	0.4
531	0.47
532	0.52
533	0.56
534	0.63
535	0.66
536	0.66
537	0.63
538	0.63
539	0.55
540	0.54
541	0.52
542	0.53
543	0.53
544	0.56
545	0.58
546	0.54
547	0.57
548	0.55
549	0.55
550	0.57
551	0.57
552	0.62
553	0.6
554	0.64
555	0.69
556	0.69
557	0.71
558	0.71
559	0.71
560	0.64

A0A0A2VT39

3D AlphaFold-predicted Structure Viewer