Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EEV9

Protein Details
Accession A7EEV9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-46NKKVIRPHGQCKKPKKYRQISISASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
KEGG ssl:SS1G_03849  -  
Amino Acid Sequences MWIRLARFGVDWVLILGTESLNKKVIRPHGQCKKPKKYRQISISASRSNLKYAEIGFHDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.05
5 0.08
6 0.09
7 0.1
8 0.14
9 0.15
10 0.16
11 0.21
12 0.29
13 0.36
14 0.4
15 0.49
16 0.55
17 0.63
18 0.7
19 0.75
20 0.78
21 0.79
22 0.82
23 0.83
24 0.83
25 0.84
26 0.83
27 0.83
28 0.78
29 0.77
30 0.75
31 0.67
32 0.6
33 0.54
34 0.48
35 0.41
36 0.34
37 0.26
38 0.22
39 0.2
40 0.23