Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VF40

Protein Details
Accession A0A0A2VF40    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
179-198DPGKYRAHRVWKDKGHKTCYBasic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MIASPLLLVALAAYATATPVASAPAPAATEWTGLTIADDAVIWDGISMSAYRDPSNWQQDSSNETAVTERVSPNPASAAAADAKGGDVGILSGPCSQGSCPDYNARFDLVYTFTAVPVPPSPDCPGCPPLTVFSSNSDIRVNDCGQCLRKKVGSSLGGSVPGGCYDFKACGRDQVICVDPGKYRAHRVWKDKGHKTCYKMKADSLGGCGFVKSRIIVHPENEVPCNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.06
8 0.07
9 0.07
10 0.07
11 0.08
12 0.09
13 0.09
14 0.11
15 0.1
16 0.11
17 0.11
18 0.11
19 0.1
20 0.09
21 0.1
22 0.08
23 0.07
24 0.06
25 0.06
26 0.05
27 0.06
28 0.06
29 0.05
30 0.04
31 0.05
32 0.04
33 0.05
34 0.05
35 0.06
36 0.09
37 0.1
38 0.11
39 0.12
40 0.17
41 0.24
42 0.32
43 0.31
44 0.3
45 0.31
46 0.32
47 0.37
48 0.36
49 0.3
50 0.21
51 0.2
52 0.2
53 0.18
54 0.18
55 0.13
56 0.12
57 0.11
58 0.14
59 0.14
60 0.14
61 0.14
62 0.13
63 0.12
64 0.11
65 0.11
66 0.09
67 0.09
68 0.08
69 0.07
70 0.07
71 0.06
72 0.06
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.09
85 0.12
86 0.12
87 0.14
88 0.19
89 0.2
90 0.21
91 0.22
92 0.19
93 0.16
94 0.15
95 0.15
96 0.11
97 0.1
98 0.1
99 0.1
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.11
106 0.09
107 0.11
108 0.14
109 0.14
110 0.15
111 0.18
112 0.2
113 0.18
114 0.19
115 0.17
116 0.17
117 0.19
118 0.2
119 0.17
120 0.16
121 0.2
122 0.19
123 0.2
124 0.19
125 0.17
126 0.16
127 0.19
128 0.18
129 0.15
130 0.16
131 0.18
132 0.21
133 0.25
134 0.26
135 0.26
136 0.28
137 0.27
138 0.29
139 0.32
140 0.32
141 0.3
142 0.31
143 0.28
144 0.26
145 0.24
146 0.22
147 0.14
148 0.11
149 0.1
150 0.07
151 0.07
152 0.08
153 0.11
154 0.13
155 0.15
156 0.15
157 0.2
158 0.22
159 0.24
160 0.24
161 0.26
162 0.25
163 0.24
164 0.25
165 0.21
166 0.2
167 0.22
168 0.27
169 0.25
170 0.29
171 0.34
172 0.44
173 0.5
174 0.57
175 0.62
176 0.67
177 0.75
178 0.78
179 0.81
180 0.79
181 0.78
182 0.76
183 0.76
184 0.75
185 0.73
186 0.67
187 0.62
188 0.6
189 0.58
190 0.55
191 0.49
192 0.41
193 0.35
194 0.31
195 0.28
196 0.22
197 0.18
198 0.17
199 0.13
200 0.15
201 0.18
202 0.24
203 0.27
204 0.28
205 0.35
206 0.38
207 0.41