Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2VV27

Protein Details
Accession A0A0A2VV27    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
313-334LSPEEQRRRRAGRENGNKIFNKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001763  Rhodanese-like_dom  
IPR036873  Rhodanese-like_dom_sf  
IPR022111  Rhodanese_C  
IPR020936  TrhO  
IPR040503  TRHO_N  
Pfam View protein in Pfam  
PF00581  Rhodanese  
PF12368  Rhodanese_C  
PF17773  UPF0176_N  
PROSITE View protein in PROSITE  
PS50206  RHODANESE_3  
CDD cd01518  RHOD_YceA  
Amino Acid Sequences MPVLHNRVSNEELRERMLAETEPRTTISFYKYFNIEAPQATRDALYQLFLSLNVFGRVYLAHEGINAQISVPESRVDALREAIYAFHPALNNLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPTFDASDVGEYLKAAEVNAMLDDPSAVFIDMRNHYEYEVGHFEDAVEIPADTFREQLPKAVDMMQDDKEKKIVMYCTGGIRCEKASAWMRHNGFKNVYHIEGGIIEYARRAREQGLPVRFVGKNFVFDERMGERISDDVIAHCHQCGTPCDSHTNCKNDGCHLLFIQCPACAEKFSGCCSEVCRDELALSPEEQRRRRAGRENGNKIFNKSRGMLNTTLGIPDPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.3
4 0.27
5 0.23
6 0.23
7 0.25
8 0.24
9 0.25
10 0.25
11 0.25
12 0.25
13 0.26
14 0.28
15 0.28
16 0.28
17 0.31
18 0.31
19 0.31
20 0.32
21 0.33
22 0.29
23 0.28
24 0.29
25 0.26
26 0.25
27 0.24
28 0.21
29 0.18
30 0.18
31 0.15
32 0.13
33 0.12
34 0.12
35 0.12
36 0.11
37 0.11
38 0.11
39 0.12
40 0.11
41 0.11
42 0.1
43 0.1
44 0.1
45 0.12
46 0.13
47 0.12
48 0.11
49 0.11
50 0.12
51 0.12
52 0.14
53 0.11
54 0.08
55 0.09
56 0.1
57 0.11
58 0.11
59 0.11
60 0.1
61 0.11
62 0.12
63 0.13
64 0.12
65 0.13
66 0.13
67 0.13
68 0.12
69 0.12
70 0.11
71 0.12
72 0.11
73 0.11
74 0.11
75 0.12
76 0.16
77 0.19
78 0.19
79 0.17
80 0.18
81 0.15
82 0.16
83 0.16
84 0.13
85 0.1
86 0.1
87 0.11
88 0.11
89 0.11
90 0.1
91 0.1
92 0.09
93 0.1
94 0.15
95 0.15
96 0.19
97 0.29
98 0.33
99 0.39
100 0.41
101 0.43
102 0.39
103 0.42
104 0.39
105 0.29
106 0.26
107 0.22
108 0.21
109 0.16
110 0.15
111 0.11
112 0.09
113 0.09
114 0.08
115 0.05
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.03
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.1
141 0.11
142 0.14
143 0.14
144 0.14
145 0.14
146 0.16
147 0.15
148 0.14
149 0.14
150 0.13
151 0.11
152 0.11
153 0.1
154 0.1
155 0.1
156 0.07
157 0.05
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.09
166 0.09
167 0.12
168 0.13
169 0.13
170 0.14
171 0.15
172 0.16
173 0.14
174 0.17
175 0.17
176 0.2
177 0.2
178 0.2
179 0.19
180 0.18
181 0.17
182 0.17
183 0.15
184 0.13
185 0.14
186 0.15
187 0.19
188 0.19
189 0.2
190 0.18
191 0.18
192 0.16
193 0.15
194 0.13
195 0.16
196 0.23
197 0.27
198 0.29
199 0.35
200 0.37
201 0.42
202 0.45
203 0.42
204 0.37
205 0.35
206 0.36
207 0.31
208 0.3
209 0.24
210 0.21
211 0.18
212 0.15
213 0.13
214 0.1
215 0.07
216 0.06
217 0.07
218 0.09
219 0.1
220 0.09
221 0.1
222 0.12
223 0.18
224 0.24
225 0.31
226 0.34
227 0.35
228 0.35
229 0.39
230 0.37
231 0.31
232 0.32
233 0.24
234 0.24
235 0.24
236 0.26
237 0.23
238 0.22
239 0.26
240 0.21
241 0.22
242 0.19
243 0.17
244 0.14
245 0.13
246 0.14
247 0.1
248 0.09
249 0.08
250 0.11
251 0.12
252 0.12
253 0.12
254 0.12
255 0.12
256 0.15
257 0.17
258 0.2
259 0.22
260 0.24
261 0.31
262 0.33
263 0.4
264 0.44
265 0.46
266 0.44
267 0.45
268 0.44
269 0.4
270 0.46
271 0.41
272 0.36
273 0.32
274 0.31
275 0.27
276 0.28
277 0.26
278 0.19
279 0.17
280 0.17
281 0.17
282 0.16
283 0.17
284 0.19
285 0.2
286 0.23
287 0.26
288 0.24
289 0.24
290 0.27
291 0.31
292 0.28
293 0.28
294 0.26
295 0.23
296 0.23
297 0.26
298 0.26
299 0.22
300 0.21
301 0.25
302 0.3
303 0.39
304 0.41
305 0.43
306 0.49
307 0.53
308 0.6
309 0.64
310 0.68
311 0.71
312 0.78
313 0.83
314 0.81
315 0.83
316 0.78
317 0.74
318 0.72
319 0.65
320 0.59
321 0.51
322 0.51
323 0.48
324 0.5
325 0.46
326 0.4
327 0.4
328 0.35
329 0.33
330 0.27