Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EH66

Protein Details
Accession A7EH66   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MIPCKSTTKEERKKGRKNSERCDFKPGHydrophilic
NLS Segment(s)
PositionSequence
13-16KKGR
Subcellular Location(s) nucl 11.5mito_nucl 11.5, mito 10.5, cyto 5
Family & Domain DBs
KEGG ssl:SS1G_04658  -  
Amino Acid Sequences MIPCKSTTKEERKKGRKNSERCDFKPGHPSRTTCGFGFVWIFHLTYAMTGLDWARKFRIYERTNGMDWLLRRKIDLLDNGLMEIKKPIVGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.9
4 0.9
5 0.9
6 0.89
7 0.89
8 0.81
9 0.79
10 0.71
11 0.65
12 0.65
13 0.59
14 0.56
15 0.51
16 0.51
17 0.46
18 0.49
19 0.48
20 0.37
21 0.37
22 0.29
23 0.25
24 0.24
25 0.2
26 0.16
27 0.14
28 0.14
29 0.09
30 0.1
31 0.08
32 0.07
33 0.08
34 0.05
35 0.04
36 0.04
37 0.05
38 0.08
39 0.09
40 0.1
41 0.11
42 0.13
43 0.14
44 0.19
45 0.29
46 0.27
47 0.32
48 0.38
49 0.4
50 0.39
51 0.39
52 0.35
53 0.29
54 0.28
55 0.31
56 0.28
57 0.24
58 0.24
59 0.25
60 0.27
61 0.29
62 0.32
63 0.29
64 0.28
65 0.28
66 0.28
67 0.3
68 0.26
69 0.22
70 0.19
71 0.15