Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EDJ4

Protein Details
Accession A7EDJ4    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-24TLYRQGVKYLRRKVRPNKHGGVQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
KEGG ssl:SS1G_03384  -  
Amino Acid Sequences MTLYRQGVKYLRRKVRPNKHGGVQSCSKITRSIKVWRENIDREGKVDREGKVHQPRFNEVPGPLPCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.86
4 0.85
5 0.81
6 0.78
7 0.77
8 0.7
9 0.65
10 0.58
11 0.5
12 0.44
13 0.39
14 0.32
15 0.31
16 0.29
17 0.27
18 0.27
19 0.34
20 0.38
21 0.44
22 0.47
23 0.47
24 0.51
25 0.5
26 0.5
27 0.49
28 0.42
29 0.37
30 0.37
31 0.32
32 0.32
33 0.33
34 0.28
35 0.26
36 0.29
37 0.37
38 0.44
39 0.5
40 0.48
41 0.48
42 0.53
43 0.53
44 0.53
45 0.47
46 0.37
47 0.39