Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VHP3

Protein Details
Accession A0A0A2VHP3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKSSRKPMGPKKACIVHBasic
NLS Segment(s)
PositionSequence
3-14KRKSSRKPMGPK
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038567  T_Elf1_sf  
Amino Acid Sequences MGKRKSSRKPMGPKKACIVHQAHLSAAVDVYGEWVDAAEAVAKEDGAHASYTGTAQAPPARRNQDHDEATSDRDESHRYGGDGIVADDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.7
4 0.67
5 0.6
6 0.53
7 0.51
8 0.46
9 0.38
10 0.33
11 0.3
12 0.23
13 0.18
14 0.13
15 0.07
16 0.06
17 0.07
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.03
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.05
42 0.06
43 0.11
44 0.14
45 0.16
46 0.23
47 0.29
48 0.3
49 0.36
50 0.42
51 0.47
52 0.46
53 0.45
54 0.44
55 0.38
56 0.4
57 0.34
58 0.28
59 0.2
60 0.19
61 0.2
62 0.17
63 0.2
64 0.19
65 0.19
66 0.2
67 0.19
68 0.2
69 0.18
70 0.16
71 0.13