Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2W3B6

Protein Details
Accession A0A0A2W3B6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, nucl 9.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVILDKSTADKLYKDVQSYRLVTVAVLVDRMKINGSLARKCISDLEEKGMIKPVTTHSKMKIYTRAIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.5
14 0.41
15 0.35
16 0.28
17 0.2
18 0.19
19 0.16
20 0.16
21 0.11
22 0.11
23 0.12
24 0.18
25 0.19
26 0.21
27 0.22
28 0.24
29 0.27
30 0.28
31 0.26
32 0.21
33 0.18
34 0.16
35 0.15
36 0.12
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.08
43 0.07
44 0.07
45 0.08
46 0.11
47 0.14
48 0.16
49 0.18
50 0.19
51 0.19
52 0.2
53 0.21
54 0.2
55 0.23
56 0.22
57 0.25
58 0.29
59 0.29
60 0.29
61 0.33
62 0.31
63 0.24
64 0.24
65 0.26
66 0.3
67 0.34
68 0.38
69 0.36
70 0.44
71 0.47
72 0.51
73 0.54
74 0.49