Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VBM9

Protein Details
Accession A0A0A2VBM9    Localization Confidence High Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-103QGAYKQKPKRGIPKKLGAKRTGBasic
236-271VKTTGLKLKRFRTRKQYLRNRRWRRERELAGQRQAQHydrophilic
280-301DAYKPGKKVVSKKAAKKAKAKKBasic
NLS Segment(s)
PositionSequence
86-101KQKPKRGIPKKLGAKR
241-301LKLKRFRTRKQYLRNRRWRRERELAGQRQAQTRRAEQGGDAYKPGKKVVSKKAAKKAKAKK
Subcellular Location(s) nucl 12, mito 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MLPPNSKFANRLVQVELQSVDAPIKVTSSASIGSAMALRFLSAQRPSLTATSTLSRLAGITLQPQLSHAVVQGQRYASVKAQGAYKQKPKRGIPKKLGAKRTGDQFVIPGNIIYKQRGTLWWPGENCNMGRDHTIHATATGYVKYYRDPARHPDRKYIGVVFDKKDTLPYPAHAERKRRLNMTAHTIREAPVKPELSASGIPFEVTRVQAGEPDRLLKLRDDYSYREDNWRIGRLVKTTGLKLKRFRTRKQYLRNRRWRRERELAGQRQAQTRRAEQGGDAYKPGKKVVSKKAAKKAKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.35
4 0.27
5 0.24
6 0.22
7 0.18
8 0.14
9 0.13
10 0.1
11 0.11
12 0.09
13 0.09
14 0.1
15 0.11
16 0.11
17 0.1
18 0.11
19 0.1
20 0.1
21 0.12
22 0.11
23 0.1
24 0.1
25 0.09
26 0.1
27 0.11
28 0.16
29 0.15
30 0.19
31 0.19
32 0.21
33 0.23
34 0.23
35 0.23
36 0.2
37 0.2
38 0.19
39 0.19
40 0.19
41 0.16
42 0.15
43 0.13
44 0.12
45 0.12
46 0.1
47 0.12
48 0.14
49 0.14
50 0.14
51 0.15
52 0.16
53 0.15
54 0.14
55 0.12
56 0.16
57 0.17
58 0.18
59 0.21
60 0.19
61 0.2
62 0.21
63 0.23
64 0.17
65 0.2
66 0.2
67 0.19
68 0.22
69 0.26
70 0.32
71 0.38
72 0.46
73 0.5
74 0.53
75 0.6
76 0.64
77 0.69
78 0.72
79 0.75
80 0.74
81 0.76
82 0.82
83 0.81
84 0.81
85 0.74
86 0.7
87 0.63
88 0.61
89 0.54
90 0.44
91 0.36
92 0.3
93 0.27
94 0.22
95 0.19
96 0.12
97 0.09
98 0.12
99 0.13
100 0.13
101 0.12
102 0.12
103 0.13
104 0.14
105 0.17
106 0.2
107 0.23
108 0.26
109 0.27
110 0.28
111 0.3
112 0.3
113 0.27
114 0.22
115 0.19
116 0.16
117 0.16
118 0.15
119 0.15
120 0.14
121 0.14
122 0.12
123 0.12
124 0.11
125 0.11
126 0.1
127 0.09
128 0.08
129 0.08
130 0.09
131 0.09
132 0.14
133 0.17
134 0.19
135 0.21
136 0.29
137 0.39
138 0.46
139 0.47
140 0.51
141 0.5
142 0.5
143 0.49
144 0.42
145 0.35
146 0.34
147 0.35
148 0.28
149 0.26
150 0.25
151 0.23
152 0.23
153 0.2
154 0.18
155 0.15
156 0.15
157 0.21
158 0.25
159 0.34
160 0.36
161 0.42
162 0.44
163 0.52
164 0.55
165 0.5
166 0.49
167 0.47
168 0.46
169 0.49
170 0.5
171 0.42
172 0.4
173 0.38
174 0.35
175 0.34
176 0.31
177 0.24
178 0.22
179 0.22
180 0.2
181 0.21
182 0.21
183 0.18
184 0.19
185 0.17
186 0.13
187 0.12
188 0.12
189 0.11
190 0.12
191 0.1
192 0.09
193 0.09
194 0.09
195 0.09
196 0.12
197 0.14
198 0.16
199 0.15
200 0.17
201 0.17
202 0.17
203 0.18
204 0.17
205 0.19
206 0.19
207 0.22
208 0.23
209 0.27
210 0.31
211 0.35
212 0.35
213 0.38
214 0.36
215 0.38
216 0.39
217 0.38
218 0.34
219 0.33
220 0.34
221 0.3
222 0.32
223 0.33
224 0.31
225 0.32
226 0.39
227 0.42
228 0.45
229 0.5
230 0.56
231 0.61
232 0.66
233 0.7
234 0.73
235 0.77
236 0.81
237 0.84
238 0.86
239 0.88
240 0.91
241 0.94
242 0.94
243 0.94
244 0.95
245 0.93
246 0.92
247 0.91
248 0.87
249 0.86
250 0.86
251 0.84
252 0.81
253 0.78
254 0.72
255 0.7
256 0.66
257 0.62
258 0.56
259 0.52
260 0.5
261 0.46
262 0.43
263 0.36
264 0.41
265 0.41
266 0.37
267 0.36
268 0.32
269 0.33
270 0.33
271 0.35
272 0.31
273 0.32
274 0.4
275 0.48
276 0.56
277 0.63
278 0.71
279 0.79
280 0.83
281 0.84