Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2V8E6

Protein Details
Accession A0A0A2V8E6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-90PGNPLGPKKKTPQKRIPQKKBasic
NLS Segment(s)
PositionSequence
29-90PKKKETPDPSKESWLRIPKGLRGETSKKPPPKRNTEGGVPGTPGNPLGPKKKTPQKRIPQKK
Subcellular Location(s) mito 15, nucl 8, cyto_nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MPRQSPLAQVGQAIRDGIPKWGGPGSYAPKKKETPDPSKESWLRIPKGLRGETSKKPPPKRNTEGGVPGTPGNPLGPKKKTPQKRIPQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.16
5 0.16
6 0.14
7 0.15
8 0.16
9 0.16
10 0.14
11 0.2
12 0.25
13 0.32
14 0.37
15 0.38
16 0.42
17 0.44
18 0.47
19 0.51
20 0.52
21 0.52
22 0.55
23 0.59
24 0.56
25 0.62
26 0.6
27 0.53
28 0.51
29 0.49
30 0.42
31 0.39
32 0.38
33 0.33
34 0.38
35 0.36
36 0.31
37 0.3
38 0.35
39 0.37
40 0.44
41 0.48
42 0.51
43 0.59
44 0.66
45 0.69
46 0.73
47 0.74
48 0.73
49 0.69
50 0.67
51 0.65
52 0.6
53 0.52
54 0.43
55 0.38
56 0.3
57 0.25
58 0.2
59 0.14
60 0.15
61 0.19
62 0.25
63 0.3
64 0.35
65 0.44
66 0.54
67 0.63
68 0.69
69 0.75
70 0.79