Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VNT9

Protein Details
Accession A0A0A2VNT9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
163-182KKEEETENKSAKKKKKKKKCBasic
NLS Segment(s)
PositionSequence
171-181KSAKKKKKKKK
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR004821  Cyt_trans-like  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0016779  F:nucleotidyltransferase activity  
GO:0009058  P:biosynthetic process  
Pfam View protein in Pfam  
PF01467  CTP_transf_like  
Amino Acid Sequences MGSTLSLPPAAADTKRRAPPASALTPKPPPSPSSSPLSPQKDSDNGVEKSPKEQQAPQPQQQQQQPPPPPHQLTPPPHQLTPPPSPPLATYTFPTGKLKRRLTQPGKTPLVLVACGSFSPITKLHVQMFELAARHIPRTDFEIVGNYLSPCRCVFLHSDDTLKKEEETENKSAKKKKKKKKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.43
4 0.43
5 0.43
6 0.48
7 0.5
8 0.53
9 0.51
10 0.49
11 0.51
12 0.57
13 0.58
14 0.54
15 0.48
16 0.41
17 0.43
18 0.46
19 0.44
20 0.44
21 0.42
22 0.45
23 0.52
24 0.55
25 0.49
26 0.44
27 0.45
28 0.41
29 0.41
30 0.4
31 0.38
32 0.33
33 0.34
34 0.37
35 0.33
36 0.34
37 0.38
38 0.37
39 0.33
40 0.37
41 0.43
42 0.5
43 0.58
44 0.6
45 0.62
46 0.62
47 0.65
48 0.65
49 0.65
50 0.6
51 0.62
52 0.61
53 0.57
54 0.58
55 0.59
56 0.56
57 0.48
58 0.48
59 0.47
60 0.47
61 0.48
62 0.52
63 0.47
64 0.45
65 0.44
66 0.41
67 0.38
68 0.38
69 0.36
70 0.29
71 0.26
72 0.27
73 0.26
74 0.27
75 0.24
76 0.19
77 0.16
78 0.19
79 0.2
80 0.21
81 0.25
82 0.25
83 0.3
84 0.38
85 0.42
86 0.42
87 0.48
88 0.57
89 0.61
90 0.64
91 0.64
92 0.64
93 0.62
94 0.57
95 0.5
96 0.42
97 0.35
98 0.28
99 0.2
100 0.11
101 0.09
102 0.08
103 0.09
104 0.07
105 0.06
106 0.09
107 0.09
108 0.11
109 0.13
110 0.16
111 0.18
112 0.19
113 0.19
114 0.19
115 0.19
116 0.19
117 0.17
118 0.15
119 0.15
120 0.15
121 0.15
122 0.15
123 0.14
124 0.13
125 0.18
126 0.2
127 0.18
128 0.17
129 0.2
130 0.19
131 0.2
132 0.2
133 0.15
134 0.15
135 0.15
136 0.16
137 0.12
138 0.14
139 0.14
140 0.15
141 0.19
142 0.22
143 0.29
144 0.29
145 0.35
146 0.35
147 0.38
148 0.38
149 0.36
150 0.29
151 0.26
152 0.3
153 0.32
154 0.36
155 0.41
156 0.47
157 0.52
158 0.6
159 0.66
160 0.7
161 0.73
162 0.78