Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VFN0

Protein Details
Accession A0A0A2VFN0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPIAKKSGKAQKQTKKFIINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPIAKKSGKAQKQTKKFIINASQPAADKIFDTAAFEKFLQERIKVEGRTNNLGDDIVIQQQGEGKIEVISHNDLSGRYLKYLTKKFLKKQQLRDWLRVVSTSRGVYELKFFNVVNDEADEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.79
4 0.74
5 0.73
6 0.71
7 0.68
8 0.64
9 0.57
10 0.52
11 0.45
12 0.43
13 0.36
14 0.27
15 0.2
16 0.15
17 0.14
18 0.11
19 0.14
20 0.14
21 0.14
22 0.16
23 0.15
24 0.16
25 0.15
26 0.2
27 0.19
28 0.18
29 0.18
30 0.21
31 0.27
32 0.26
33 0.28
34 0.28
35 0.3
36 0.34
37 0.33
38 0.28
39 0.23
40 0.21
41 0.18
42 0.14
43 0.11
44 0.08
45 0.07
46 0.07
47 0.06
48 0.08
49 0.09
50 0.08
51 0.07
52 0.06
53 0.07
54 0.07
55 0.08
56 0.08
57 0.09
58 0.08
59 0.08
60 0.09
61 0.08
62 0.1
63 0.14
64 0.13
65 0.12
66 0.14
67 0.16
68 0.24
69 0.29
70 0.34
71 0.39
72 0.45
73 0.52
74 0.6
75 0.68
76 0.69
77 0.74
78 0.78
79 0.8
80 0.78
81 0.77
82 0.72
83 0.63
84 0.56
85 0.48
86 0.41
87 0.34
88 0.32
89 0.27
90 0.23
91 0.23
92 0.23
93 0.21
94 0.24
95 0.22
96 0.2
97 0.22
98 0.21
99 0.21
100 0.24
101 0.24
102 0.2
103 0.19
104 0.18