Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VCN2

Protein Details
Accession A0A0A2VCN2    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-32IPKTRNTYCKGKECRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVKCKTKCQLALKRCKHFELGARGTKHTNQYFSYSGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.77
4 0.83
5 0.83
6 0.85
7 0.86
8 0.87
9 0.84
10 0.86
11 0.88
12 0.81
13 0.8
14 0.75
15 0.7
16 0.62
17 0.57
18 0.46
19 0.38
20 0.36
21 0.35
22 0.34
23 0.3
24 0.36
25 0.39
26 0.44
27 0.49
28 0.54
29 0.51
30 0.57
31 0.64
32 0.62
33 0.63
34 0.62
35 0.61
36 0.59
37 0.61
38 0.52
39 0.47
40 0.43
41 0.36
42 0.37
43 0.38
44 0.37
45 0.31
46 0.37
47 0.4
48 0.49
49 0.57
50 0.59
51 0.58
52 0.61
53 0.68
54 0.69
55 0.67
56 0.62
57 0.59
58 0.6
59 0.59
60 0.58
61 0.53
62 0.53
63 0.48
64 0.49
65 0.49
66 0.48
67 0.5
68 0.55
69 0.61
70 0.63
71 0.73
72 0.76
73 0.79
74 0.75
75 0.69
76 0.62
77 0.56
78 0.53
79 0.52
80 0.51
81 0.5
82 0.49
83 0.49
84 0.49
85 0.5
86 0.51
87 0.45
88 0.41
89 0.35
90 0.38
91 0.38
92 0.38
93 0.43
94 0.38
95 0.4
96 0.44
97 0.43
98 0.39
99 0.42
100 0.42