Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F0Q0

Protein Details
Accession A7F0Q0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-37MIYRCCVRPGLRRRRERKEKKERVRKESEERREREBasic
NLS Segment(s)
PositionSequence
12-60GLRRRRERKEKKERVRKESEERREREEREKEIRRLREEKEVLGRERERW
Subcellular Location(s) mito 14.5, cyto_mito 9.5, nucl 9
Family & Domain DBs
KEGG ssl:SS1G_11169  -  
Amino Acid Sequences MYMIYRCCVRPGLRRRRERKEKKERVRKESEERREREEREKEIRRLREEKEVLGRERERWISARGGRGEGSWEEVGLGERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.84
4 0.9
5 0.92
6 0.92
7 0.92
8 0.93
9 0.94
10 0.96
11 0.94
12 0.91
13 0.9
14 0.86
15 0.85
16 0.84
17 0.84
18 0.82
19 0.75
20 0.73
21 0.69
22 0.65
23 0.64
24 0.59
25 0.55
26 0.55
27 0.59
28 0.58
29 0.6
30 0.62
31 0.59
32 0.58
33 0.54
34 0.54
35 0.49
36 0.45
37 0.46
38 0.46
39 0.41
40 0.43
41 0.42
42 0.35
43 0.38
44 0.37
45 0.31
46 0.29
47 0.3
48 0.31
49 0.33
50 0.38
51 0.35
52 0.35
53 0.33
54 0.31
55 0.32
56 0.25
57 0.26
58 0.19
59 0.17
60 0.15
61 0.15