Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VBL1

Protein Details
Accession A0A0A2VBL1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
144-169RADAERATRKREKRNKKKQVVEETVLHydrophilic
NLS Segment(s)
PositionSequence
11-15KKRKP
150-161ATRKREKRNKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPAAEANHASKKRKPSTSIANPAASKKARHPPSDGLPPGPPHDSPLCAPHAPILHELGAKYDVLPASVISSTPIRKRLVHITTHLLGGAVGGGDGRKKPRVVLLHARATEVCKMITVAEKCKRLLEEQGEATWYQYNQLFDVSRADAERATRKREKRNKKKQVVEETVLHVKEGEKEEEDEGEEEEEEEDDGDESDAFETMQARFEKAVLPPAPDRTTKSLRIFLSTVAIPELKAKDGVTVQTSGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.69
4 0.75
5 0.79
6 0.74
7 0.71
8 0.65
9 0.63
10 0.62
11 0.54
12 0.46
13 0.44
14 0.49
15 0.5
16 0.52
17 0.55
18 0.54
19 0.59
20 0.66
21 0.61
22 0.54
23 0.5
24 0.49
25 0.46
26 0.42
27 0.34
28 0.28
29 0.28
30 0.27
31 0.25
32 0.26
33 0.28
34 0.25
35 0.25
36 0.24
37 0.25
38 0.24
39 0.24
40 0.22
41 0.19
42 0.2
43 0.19
44 0.18
45 0.16
46 0.14
47 0.12
48 0.13
49 0.11
50 0.1
51 0.1
52 0.08
53 0.09
54 0.09
55 0.09
56 0.08
57 0.11
58 0.14
59 0.18
60 0.23
61 0.23
62 0.25
63 0.28
64 0.36
65 0.38
66 0.38
67 0.38
68 0.39
69 0.37
70 0.36
71 0.32
72 0.22
73 0.18
74 0.14
75 0.1
76 0.04
77 0.03
78 0.03
79 0.03
80 0.04
81 0.06
82 0.09
83 0.12
84 0.12
85 0.13
86 0.19
87 0.23
88 0.29
89 0.37
90 0.41
91 0.45
92 0.45
93 0.45
94 0.39
95 0.37
96 0.32
97 0.23
98 0.16
99 0.1
100 0.09
101 0.09
102 0.14
103 0.14
104 0.19
105 0.24
106 0.26
107 0.27
108 0.28
109 0.28
110 0.24
111 0.28
112 0.24
113 0.22
114 0.21
115 0.2
116 0.2
117 0.19
118 0.18
119 0.14
120 0.11
121 0.09
122 0.1
123 0.1
124 0.09
125 0.11
126 0.11
127 0.1
128 0.12
129 0.11
130 0.1
131 0.1
132 0.1
133 0.1
134 0.12
135 0.2
136 0.21
137 0.28
138 0.35
139 0.42
140 0.52
141 0.62
142 0.71
143 0.74
144 0.83
145 0.87
146 0.89
147 0.91
148 0.9
149 0.9
150 0.86
151 0.79
152 0.7
153 0.64
154 0.59
155 0.49
156 0.39
157 0.29
158 0.22
159 0.22
160 0.23
161 0.2
162 0.16
163 0.18
164 0.19
165 0.19
166 0.19
167 0.15
168 0.13
169 0.11
170 0.1
171 0.09
172 0.08
173 0.08
174 0.06
175 0.06
176 0.06
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.06
183 0.05
184 0.05
185 0.06
186 0.07
187 0.07
188 0.13
189 0.13
190 0.14
191 0.14
192 0.15
193 0.17
194 0.17
195 0.26
196 0.21
197 0.26
198 0.27
199 0.33
200 0.36
201 0.36
202 0.4
203 0.39
204 0.43
205 0.47
206 0.5
207 0.5
208 0.48
209 0.51
210 0.47
211 0.4
212 0.38
213 0.31
214 0.26
215 0.21
216 0.21
217 0.16
218 0.2
219 0.21
220 0.18
221 0.19
222 0.18
223 0.19
224 0.22
225 0.25
226 0.22