Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TN03

Protein Details
Accession A7TN03    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNVPKTRKTYCKGRECRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vpo:Kpol_1051p41  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGRECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQAGFGGQTKPVFHKKAKTTKKVVLRLECVNCKTKAQLTLKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.84
4 0.89
5 0.88
6 0.89
7 0.88
8 0.89
9 0.86
10 0.86
11 0.88
12 0.81
13 0.8
14 0.73
15 0.69
16 0.61
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.48
30 0.54
31 0.61
32 0.58
33 0.59
34 0.57
35 0.54
36 0.52
37 0.5
38 0.43
39 0.37
40 0.32
41 0.25
42 0.26
43 0.28
44 0.28
45 0.27
46 0.32
47 0.36
48 0.47
49 0.55
50 0.6
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.66
57 0.61
58 0.6
59 0.59
60 0.57
61 0.51
62 0.48
63 0.42
64 0.38
65 0.36
66 0.33
67 0.36
68 0.4
69 0.46
70 0.49
71 0.59
72 0.66
73 0.7
74 0.68
75 0.63
76 0.59
77 0.53
78 0.53
79 0.53
80 0.53
81 0.55
82 0.62
83 0.59
84 0.59
85 0.61
86 0.57