Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EWY9

Protein Details
Accession A7EWY9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-75ANVFVKEEKRNNRERRRRRNTRGGMADRGKBasic
NLS Segment(s)
PositionSequence
53-80EKRNNRERRRRRNTRGGMADRGKIGKQR
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
KEGG ssl:SS1G_09848  -  
Amino Acid Sequences MCGRCLTKQGVHIDKDFLQEANARRRSEAAEIRQSTILTLKILEQANVFVKEEKRNNRERRRRRNTRGGMADRGKIGKQRKCVVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.35
4 0.26
5 0.21
6 0.22
7 0.26
8 0.32
9 0.37
10 0.34
11 0.33
12 0.35
13 0.36
14 0.38
15 0.39
16 0.36
17 0.39
18 0.4
19 0.41
20 0.41
21 0.38
22 0.31
23 0.26
24 0.2
25 0.11
26 0.1
27 0.08
28 0.12
29 0.12
30 0.12
31 0.11
32 0.12
33 0.14
34 0.15
35 0.15
36 0.13
37 0.15
38 0.22
39 0.29
40 0.36
41 0.4
42 0.49
43 0.59
44 0.68
45 0.76
46 0.81
47 0.86
48 0.88
49 0.93
50 0.93
51 0.93
52 0.91
53 0.9
54 0.9
55 0.84
56 0.82
57 0.75
58 0.68
59 0.6
60 0.53
61 0.46
62 0.43
63 0.46
64 0.43
65 0.48