Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2VD31

Protein Details
Accession A0A0A2VD31    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKNKKAQNIKFKVRCQKHHydrophilic
NLS Segment(s)
PositionSequence
23-31ARIKKNKKA
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKFIEICRRKDASSARIKKNKKAQNIKFKVRCQKHLYTLVLKDTEKAEKLKQSLPPSMRPPRRGIELEYFLAERIAANRIALPEGIPTRWSIALQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.51
4 0.46
5 0.52
6 0.56
7 0.55
8 0.58
9 0.62
10 0.62
11 0.68
12 0.72
13 0.74
14 0.77
15 0.75
16 0.75
17 0.76
18 0.76
19 0.78
20 0.83
21 0.85
22 0.83
23 0.83
24 0.83
25 0.77
26 0.75
27 0.71
28 0.68
29 0.64
30 0.63
31 0.58
32 0.52
33 0.49
34 0.43
35 0.38
36 0.33
37 0.27
38 0.21
39 0.2
40 0.17
41 0.17
42 0.17
43 0.18
44 0.21
45 0.24
46 0.28
47 0.31
48 0.36
49 0.37
50 0.41
51 0.45
52 0.53
53 0.55
54 0.53
55 0.53
56 0.5
57 0.53
58 0.49
59 0.46
60 0.43
61 0.41
62 0.38
63 0.35
64 0.32
65 0.26
66 0.23
67 0.19
68 0.11
69 0.09
70 0.1
71 0.09
72 0.09
73 0.1
74 0.11
75 0.13
76 0.12
77 0.11
78 0.14
79 0.17
80 0.17
81 0.16
82 0.16
83 0.18
84 0.2