Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EP58

Protein Details
Accession A7EP58    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
138-157SSRKGWSKSIRMRDHRSGNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
KEGG ssl:SS1G_07107  -  
Amino Acid Sequences MRICGYGYFVPAGRGTPVVVCSPARDRDVVVGPMPASFLIQAKSHKTRVVEVWKVRFAGKAWLCMVSKLQGWLGPATGPLPLTHHGKAILDAGNCIYVFIQQESLEGLQVDGGGLSCLIQTPLHLKGAVSGVRQYEESSRKGWSKSIRMRDHRSGNVRLADYVVYKREIDEKTINYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.15
5 0.14
6 0.16
7 0.15
8 0.18
9 0.22
10 0.26
11 0.26
12 0.25
13 0.24
14 0.27
15 0.31
16 0.29
17 0.25
18 0.22
19 0.2
20 0.19
21 0.19
22 0.14
23 0.1
24 0.08
25 0.09
26 0.09
27 0.12
28 0.15
29 0.21
30 0.26
31 0.28
32 0.31
33 0.31
34 0.32
35 0.37
36 0.43
37 0.45
38 0.45
39 0.48
40 0.48
41 0.47
42 0.44
43 0.38
44 0.3
45 0.32
46 0.27
47 0.26
48 0.24
49 0.27
50 0.27
51 0.26
52 0.26
53 0.18
54 0.17
55 0.14
56 0.14
57 0.11
58 0.12
59 0.11
60 0.1
61 0.08
62 0.08
63 0.07
64 0.07
65 0.06
66 0.05
67 0.07
68 0.1
69 0.13
70 0.13
71 0.14
72 0.14
73 0.14
74 0.14
75 0.14
76 0.14
77 0.1
78 0.1
79 0.09
80 0.1
81 0.09
82 0.09
83 0.07
84 0.06
85 0.07
86 0.07
87 0.08
88 0.07
89 0.07
90 0.08
91 0.08
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.04
107 0.05
108 0.08
109 0.1
110 0.11
111 0.11
112 0.11
113 0.12
114 0.17
115 0.18
116 0.17
117 0.17
118 0.17
119 0.17
120 0.18
121 0.17
122 0.21
123 0.23
124 0.24
125 0.23
126 0.27
127 0.3
128 0.31
129 0.35
130 0.36
131 0.42
132 0.5
133 0.59
134 0.64
135 0.7
136 0.77
137 0.8
138 0.8
139 0.78
140 0.76
141 0.71
142 0.67
143 0.63
144 0.56
145 0.47
146 0.4
147 0.33
148 0.3
149 0.28
150 0.25
151 0.22
152 0.21
153 0.22
154 0.28
155 0.28
156 0.31
157 0.34