Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VPP8

Protein Details
Accession A0A0A2VPP8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35KVQEIIKKKLNKNKAEKPAATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 9
Family & Domain DBs
Amino Acid Sequences MGGIPFGALENIKNKVQEIIKKKLNKNKAEKPAATETTAVAAAPAAADATKTEATAPAAPTNAGASTAPGAAPANKVDVAAVEAPQVTEAPKDAAAEAPAVSAEPAAVPNAAPVVDKPAATPAPAAATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.29
4 0.36
5 0.39
6 0.44
7 0.51
8 0.59
9 0.66
10 0.7
11 0.74
12 0.75
13 0.78
14 0.79
15 0.81
16 0.81
17 0.74
18 0.71
19 0.69
20 0.62
21 0.53
22 0.44
23 0.34
24 0.26
25 0.25
26 0.18
27 0.1
28 0.07
29 0.05
30 0.05
31 0.04
32 0.03
33 0.02
34 0.03
35 0.03
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.09
42 0.11
43 0.12
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.08
50 0.07
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.06
70 0.06
71 0.06
72 0.07
73 0.07
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08
81 0.09
82 0.09
83 0.1
84 0.09
85 0.07
86 0.07
87 0.06
88 0.06
89 0.05
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.13
102 0.14
103 0.14
104 0.15
105 0.2
106 0.21
107 0.21
108 0.21
109 0.16