Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ET43

Protein Details
Accession A7ET43   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-53YITCTYFSRRKKVRKGQYPGGPKMHydrophilic
NLS Segment(s)
PositionSequence
40-43KKVR
90-107EKRTGRRKAGDRRGVGRR
Subcellular Location(s) cyto 10.5, cyto_nucl 8, nucl 4.5, extr 4, E.R. 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
KEGG ssl:SS1G_08498  -  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MAVAGIGADCLLNTILFMLGVIPGHIHGFYITCTYFSRRKKVRKGQYPGGPKMGIYSERVWYGGASAKRVDELWEKREDERLEKSDRDEEKRTGRRKAGDRRGVGRRNEVMRMHSDIGAMRVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.04
6 0.04
7 0.05
8 0.05
9 0.04
10 0.05
11 0.06
12 0.06
13 0.06
14 0.05
15 0.06
16 0.07
17 0.09
18 0.09
19 0.1
20 0.11
21 0.16
22 0.24
23 0.28
24 0.37
25 0.44
26 0.53
27 0.63
28 0.72
29 0.78
30 0.81
31 0.85
32 0.83
33 0.83
34 0.82
35 0.74
36 0.68
37 0.57
38 0.46
39 0.39
40 0.32
41 0.24
42 0.18
43 0.17
44 0.14
45 0.14
46 0.15
47 0.13
48 0.11
49 0.11
50 0.13
51 0.12
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.14
58 0.17
59 0.2
60 0.23
61 0.27
62 0.29
63 0.29
64 0.36
65 0.35
66 0.31
67 0.33
68 0.34
69 0.34
70 0.33
71 0.36
72 0.38
73 0.41
74 0.43
75 0.42
76 0.43
77 0.49
78 0.56
79 0.6
80 0.59
81 0.6
82 0.62
83 0.67
84 0.73
85 0.73
86 0.74
87 0.73
88 0.74
89 0.78
90 0.77
91 0.71
92 0.68
93 0.64
94 0.59
95 0.59
96 0.54
97 0.48
98 0.45
99 0.47
100 0.41
101 0.35
102 0.32
103 0.27