Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VU63

Protein Details
Accession A0A0A2VU63    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-91QTIRARRKRHFNAEHQHTRKBasic
NLS Segment(s)
PositionSequence
77-79RRK
Subcellular Location(s) nucl 18, mito 6, cyto 1, extr 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013321  Arc_rbn_hlx_hlx  
IPR009390  MatP  
IPR035375  MatP_C  
IPR035087  MatP_N  
IPR038339  MatP_N_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043565  F:sequence-specific DNA binding  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF06303  MatP  
PF17414  MatP_C  
Amino Acid Sequences MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVEQLLTLENVPVLVQSWIDQHMNPALHNRMKQTIRARRKRHFNAEHQHTRKKSIDLEYLVWQRLAGLAQRRGNTLSETVVQLIEDAERKEKVESKMSTLKQDLQAMLGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.28
4 0.36
5 0.46
6 0.52
7 0.6
8 0.64
9 0.7
10 0.7
11 0.64
12 0.62
13 0.6
14 0.53
15 0.44
16 0.4
17 0.33
18 0.28
19 0.25
20 0.17
21 0.1
22 0.08
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.05
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.06
44 0.08
45 0.09
46 0.09
47 0.09
48 0.12
49 0.13
50 0.13
51 0.15
52 0.17
53 0.2
54 0.21
55 0.22
56 0.25
57 0.25
58 0.31
59 0.37
60 0.43
61 0.51
62 0.6
63 0.65
64 0.66
65 0.76
66 0.77
67 0.78
68 0.76
69 0.74
70 0.75
71 0.77
72 0.8
73 0.75
74 0.75
75 0.65
76 0.64
77 0.57
78 0.5
79 0.45
80 0.4
81 0.4
82 0.35
83 0.37
84 0.37
85 0.38
86 0.35
87 0.3
88 0.25
89 0.19
90 0.17
91 0.15
92 0.12
93 0.16
94 0.22
95 0.26
96 0.27
97 0.29
98 0.3
99 0.3
100 0.28
101 0.23
102 0.19
103 0.17
104 0.17
105 0.16
106 0.14
107 0.13
108 0.11
109 0.1
110 0.09
111 0.1
112 0.11
113 0.13
114 0.14
115 0.16
116 0.19
117 0.25
118 0.28
119 0.34
120 0.35
121 0.39
122 0.48
123 0.5
124 0.53
125 0.5
126 0.52
127 0.49
128 0.51
129 0.44
130 0.38