Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2VJF4

Protein Details
Accession A0A0A2VJF4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-41LDDAPYVHQKKKKKRTGRKKRRAITGFEBasic
NLS Segment(s)
PositionSequence
23-35KKKKKRTGRKKRR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018606  Arb1  
Gene Ontology GO:0033167  C:ARC complex  
GO:0031047  P:RNA-mediated gene silencing  
Pfam View protein in Pfam  
PF09692  Arb1  
Amino Acid Sequences MIMDSDHEHDGLELDDAPYVHQKKKKKRTGRKKRRAITGFEEYYADAPTTPEEARREQEELYARQDNSAPSSHYIQTRLIFLPQLDPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.09
5 0.16
6 0.19
7 0.24
8 0.3
9 0.39
10 0.49
11 0.6
12 0.69
13 0.73
14 0.81
15 0.86
16 0.92
17 0.95
18 0.95
19 0.94
20 0.91
21 0.91
22 0.84
23 0.78
24 0.74
25 0.7
26 0.6
27 0.5
28 0.43
29 0.32
30 0.28
31 0.22
32 0.15
33 0.07
34 0.06
35 0.06
36 0.08
37 0.08
38 0.11
39 0.13
40 0.15
41 0.18
42 0.2
43 0.21
44 0.19
45 0.24
46 0.25
47 0.25
48 0.29
49 0.31
50 0.29
51 0.28
52 0.3
53 0.26
54 0.24
55 0.24
56 0.2
57 0.18
58 0.22
59 0.25
60 0.26
61 0.27
62 0.28
63 0.27
64 0.29
65 0.27
66 0.25
67 0.24
68 0.22