Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2VQK5

Protein Details
Accession A0A0A2VQK5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
128-167WPTAKNPRCGWRHRRHCLSHDLARPRPKRQPQHPRHHLRHBasic
NLS Segment(s)
PositionSequence
151-164RPRPKRQPQHPRHH
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023576  UbiE/COQ5_MeTrFase_CS  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005759  C:mitochondrial matrix  
GO:0043334  F:2-hexaprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity  
GO:0043333  F:2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity  
GO:0009060  P:aerobic respiration  
GO:0032259  P:methylation  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF01209  Ubie_methyltran  
PROSITE View protein in PROSITE  
PS01183  UBIE_1  
Amino Acid Sequences MRAAAARQQPMRQISTTAARRHKTEHQQSRTTHFGFETVNEEEKAGRVAGVFTSVAESYDKMNDLMSFGVHRLWKYGQNCPPMKMPPPPPSKKLVTMTPTDINANQSDSHQQGLLRFLTKPRCDDSAWPTAKNPRCGWRHRRHCLSHDLARPRPKRQPQHPRHHLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.44
4 0.46
5 0.5
6 0.49
7 0.5
8 0.54
9 0.6
10 0.61
11 0.65
12 0.67
13 0.67
14 0.72
15 0.72
16 0.73
17 0.7
18 0.6
19 0.5
20 0.4
21 0.34
22 0.27
23 0.25
24 0.23
25 0.19
26 0.2
27 0.19
28 0.19
29 0.17
30 0.16
31 0.16
32 0.11
33 0.09
34 0.06
35 0.07
36 0.06
37 0.08
38 0.07
39 0.06
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.08
46 0.09
47 0.1
48 0.08
49 0.09
50 0.08
51 0.08
52 0.08
53 0.07
54 0.06
55 0.06
56 0.09
57 0.09
58 0.09
59 0.11
60 0.12
61 0.18
62 0.2
63 0.28
64 0.31
65 0.38
66 0.4
67 0.39
68 0.41
69 0.38
70 0.38
71 0.36
72 0.37
73 0.37
74 0.46
75 0.47
76 0.47
77 0.5
78 0.49
79 0.49
80 0.46
81 0.42
82 0.36
83 0.34
84 0.35
85 0.32
86 0.3
87 0.26
88 0.24
89 0.2
90 0.18
91 0.16
92 0.13
93 0.12
94 0.14
95 0.14
96 0.14
97 0.13
98 0.13
99 0.13
100 0.16
101 0.16
102 0.14
103 0.14
104 0.19
105 0.26
106 0.28
107 0.3
108 0.3
109 0.32
110 0.32
111 0.37
112 0.38
113 0.4
114 0.4
115 0.38
116 0.38
117 0.44
118 0.49
119 0.51
120 0.49
121 0.47
122 0.52
123 0.61
124 0.68
125 0.7
126 0.75
127 0.78
128 0.84
129 0.82
130 0.81
131 0.8
132 0.77
133 0.75
134 0.73
135 0.72
136 0.7
137 0.73
138 0.72
139 0.71
140 0.74
141 0.75
142 0.77
143 0.79
144 0.83
145 0.84
146 0.9
147 0.93