Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2VG45

Protein Details
Accession A0A0A2VG45    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-34SEDRKARLAKLKSLKRKQPTDEFVHydrophilic
NLS Segment(s)
PositionSequence
19-25AKLKSLK
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013169  mRNA_splic_Cwf18-like  
Pfam View protein in Pfam  
PF08315  cwf18  
Amino Acid Sequences MSSHTALSAASEDRKARLAKLKSLKRKQPTDEFVALEANERLPATSSHKENEDADGEDAPPDVTHLHLSGRNYDPETRGPKLGFEAPPTLADDKATLEQQAADLEAQVKQQAATEAAEQKGIDLFKLQPKKPNWDLKRNLEQKMDVLNVRTDNAIARLVKDRITAAQKAAQKSSSGEDVEAVGMDGATLVESLRVREQEEEEEERREKEEDEALTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.3
4 0.37
5 0.39
6 0.44
7 0.54
8 0.62
9 0.68
10 0.77
11 0.81
12 0.81
13 0.85
14 0.84
15 0.83
16 0.79
17 0.76
18 0.7
19 0.62
20 0.53
21 0.47
22 0.38
23 0.3
24 0.24
25 0.17
26 0.13
27 0.12
28 0.11
29 0.1
30 0.12
31 0.17
32 0.23
33 0.25
34 0.27
35 0.29
36 0.31
37 0.3
38 0.32
39 0.26
40 0.22
41 0.21
42 0.19
43 0.17
44 0.15
45 0.14
46 0.11
47 0.08
48 0.07
49 0.06
50 0.06
51 0.07
52 0.07
53 0.09
54 0.11
55 0.13
56 0.17
57 0.19
58 0.21
59 0.22
60 0.24
61 0.24
62 0.28
63 0.32
64 0.29
65 0.29
66 0.27
67 0.25
68 0.26
69 0.29
70 0.24
71 0.21
72 0.22
73 0.2
74 0.2
75 0.21
76 0.19
77 0.14
78 0.13
79 0.11
80 0.1
81 0.11
82 0.1
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.06
98 0.06
99 0.07
100 0.07
101 0.08
102 0.11
103 0.11
104 0.11
105 0.11
106 0.1
107 0.11
108 0.1
109 0.09
110 0.08
111 0.09
112 0.16
113 0.23
114 0.24
115 0.3
116 0.33
117 0.41
118 0.48
119 0.57
120 0.56
121 0.6
122 0.66
123 0.66
124 0.74
125 0.72
126 0.68
127 0.6
128 0.54
129 0.45
130 0.42
131 0.36
132 0.27
133 0.22
134 0.21
135 0.19
136 0.19
137 0.17
138 0.13
139 0.12
140 0.12
141 0.14
142 0.12
143 0.13
144 0.18
145 0.19
146 0.2
147 0.2
148 0.19
149 0.21
150 0.25
151 0.25
152 0.22
153 0.27
154 0.31
155 0.33
156 0.34
157 0.3
158 0.27
159 0.27
160 0.27
161 0.26
162 0.22
163 0.19
164 0.17
165 0.17
166 0.16
167 0.14
168 0.11
169 0.06
170 0.05
171 0.05
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.06
178 0.07
179 0.09
180 0.13
181 0.15
182 0.16
183 0.19
184 0.22
185 0.25
186 0.3
187 0.35
188 0.34
189 0.39
190 0.39
191 0.37
192 0.37
193 0.33
194 0.28
195 0.25
196 0.29