Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VUH9

Protein Details
Accession A0A0A2VUH9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-75KEVMKKVRKARRARDKLMDKHGEBasic
NLS Segment(s)
PositionSequence
57-69KKVRKARRARDKL
Subcellular Location(s) cyto 16, cyto_nucl 12.5, nucl 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021661  Rap1_C  
IPR038104  Rap1_C_sf  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF11626  Rap1_C  
Amino Acid Sequences MVLGLATVVMQSLRDGRGVPARYEGVWTDRDDESLRLVVDVGPQALETDVRDKEVMKKVRKARRARDKLMDKHGEERMALRIKYLKATGRLAAAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.13
4 0.21
5 0.23
6 0.23
7 0.24
8 0.25
9 0.24
10 0.25
11 0.24
12 0.19
13 0.19
14 0.19
15 0.19
16 0.18
17 0.19
18 0.18
19 0.18
20 0.16
21 0.15
22 0.14
23 0.1
24 0.11
25 0.09
26 0.09
27 0.09
28 0.07
29 0.06
30 0.05
31 0.06
32 0.05
33 0.05
34 0.05
35 0.07
36 0.08
37 0.09
38 0.09
39 0.09
40 0.16
41 0.24
42 0.31
43 0.33
44 0.41
45 0.49
46 0.58
47 0.67
48 0.7
49 0.72
50 0.76
51 0.8
52 0.79
53 0.8
54 0.81
55 0.8
56 0.8
57 0.76
58 0.67
59 0.64
60 0.6
61 0.51
62 0.42
63 0.36
64 0.34
65 0.33
66 0.31
67 0.28
68 0.3
69 0.3
70 0.34
71 0.37
72 0.35
73 0.34
74 0.38
75 0.37
76 0.34