Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VFI2

Protein Details
Accession A0A0A2VFI2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
99-128PDPARSRPGQLRRGRCCRRVSGSRARRPAPHydrophilic
NLS Segment(s)
PositionSequence
121-127SRARRPA
Subcellular Location(s) cyto 10, cyto_nucl 9.5, nucl 7, mito 5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MESFTIKTPCSSANIGPGFDVIGLALSIYLELRVTVDRGKTRSEAPLNCRITYEGQGEGGSDISLNPHEQPHHARCPLRPALSRPARVPDRDARAHQEPDPARSRPGQLRRGRCCRRVSGSRARRPAPPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.27
4 0.25
5 0.21
6 0.17
7 0.16
8 0.07
9 0.05
10 0.04
11 0.04
12 0.04
13 0.03
14 0.03
15 0.03
16 0.04
17 0.03
18 0.03
19 0.05
20 0.05
21 0.07
22 0.09
23 0.13
24 0.17
25 0.19
26 0.22
27 0.22
28 0.24
29 0.3
30 0.34
31 0.35
32 0.37
33 0.45
34 0.45
35 0.43
36 0.42
37 0.36
38 0.32
39 0.3
40 0.26
41 0.17
42 0.15
43 0.14
44 0.14
45 0.12
46 0.1
47 0.06
48 0.05
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.09
57 0.16
58 0.2
59 0.26
60 0.3
61 0.31
62 0.31
63 0.38
64 0.41
65 0.4
66 0.38
67 0.36
68 0.43
69 0.48
70 0.5
71 0.44
72 0.47
73 0.46
74 0.44
75 0.45
76 0.42
77 0.42
78 0.44
79 0.45
80 0.44
81 0.45
82 0.47
83 0.43
84 0.44
85 0.39
86 0.41
87 0.44
88 0.38
89 0.35
90 0.35
91 0.39
92 0.4
93 0.47
94 0.51
95 0.54
96 0.63
97 0.71
98 0.79
99 0.82
100 0.8
101 0.78
102 0.77
103 0.77
104 0.76
105 0.75
106 0.75
107 0.77
108 0.8
109 0.82
110 0.76