Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2W160

Protein Details
Accession A0A0A2W160    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MAHHPPRRPRPIRRGRHHHHRRSKVCRRADPQPRQVBasic
NLS Segment(s)
PositionSequence
5-24PPRRPRPIRRGRHHHHRRSK
Subcellular Location(s) mito 15, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MAHHPPRRPRPIRRGRHHHHRRSKVCRRADPQPRQVVAHEHHVVCAAVQRHAPSLTGLGFGAPPLKVLQDLGLGGLRSHLRTMREREPGQGVISGAANIRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.92
4 0.92
5 0.92
6 0.92
7 0.92
8 0.91
9 0.92
10 0.93
11 0.91
12 0.89
13 0.88
14 0.82
15 0.82
16 0.82
17 0.81
18 0.79
19 0.78
20 0.7
21 0.62
22 0.58
23 0.54
24 0.45
25 0.42
26 0.37
27 0.28
28 0.27
29 0.26
30 0.24
31 0.18
32 0.19
33 0.12
34 0.1
35 0.11
36 0.11
37 0.12
38 0.12
39 0.12
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.07
46 0.06
47 0.06
48 0.07
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.11
63 0.11
64 0.1
65 0.12
66 0.15
67 0.17
68 0.24
69 0.31
70 0.37
71 0.45
72 0.45
73 0.48
74 0.5
75 0.48
76 0.42
77 0.37
78 0.3
79 0.22
80 0.22
81 0.18