Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2VSG5

Protein Details
Accession A0A0A2VSG5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSEPTSPNPRPKTRRNISFANHydrophilic
NLS Segment(s)
PositionSequence
42-55GGAAGRPRPSAPRS
63-64RR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSEPTSPNPRPKTRRNISFANVNWNTRPSAGSRRTASHGGGGGAAGRPRPSAPRSISFAHPLRRKHSALTHAHNRPGAPPRALSFCDTRFTPSGPNLALRQGSVSGPFAFLNPTTAIFDIRADDGLADGEHPEQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.73
5 0.74
6 0.66
7 0.65
8 0.58
9 0.51
10 0.47
11 0.41
12 0.38
13 0.29
14 0.29
15 0.22
16 0.29
17 0.3
18 0.35
19 0.36
20 0.39
21 0.42
22 0.43
23 0.4
24 0.33
25 0.29
26 0.23
27 0.2
28 0.16
29 0.12
30 0.11
31 0.11
32 0.09
33 0.08
34 0.08
35 0.09
36 0.14
37 0.15
38 0.2
39 0.24
40 0.27
41 0.31
42 0.33
43 0.34
44 0.36
45 0.38
46 0.4
47 0.41
48 0.4
49 0.4
50 0.43
51 0.42
52 0.38
53 0.39
54 0.39
55 0.39
56 0.43
57 0.48
58 0.45
59 0.47
60 0.45
61 0.4
62 0.36
63 0.37
64 0.33
65 0.25
66 0.24
67 0.23
68 0.26
69 0.27
70 0.25
71 0.22
72 0.21
73 0.22
74 0.22
75 0.24
76 0.21
77 0.21
78 0.22
79 0.2
80 0.22
81 0.2
82 0.22
83 0.19
84 0.21
85 0.2
86 0.17
87 0.17
88 0.15
89 0.14
90 0.13
91 0.15
92 0.12
93 0.13
94 0.13
95 0.12
96 0.12
97 0.12
98 0.13
99 0.12
100 0.13
101 0.13
102 0.14
103 0.15
104 0.14
105 0.14
106 0.13
107 0.13
108 0.13
109 0.11
110 0.1
111 0.09
112 0.1
113 0.09
114 0.08
115 0.08