Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2V6C7

Protein Details
Accession A0A0A2V6C7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-117KSFQLEKARRHERREKRRKRQEMGPRRRSGSBasic
NLS Segment(s)
PositionSequence
29-51KRKARQKAVKSGQLSKGDARKLK
93-123KARRHERREKRRKRQEMGPRRRSGSLPAPRK
Subcellular Location(s) nucl 11, mito_nucl 10.666, mito 9, cyto_nucl 7.666, cyto_mito 6.666, cyto 3
Family & Domain DBs
Amino Acid Sequences MRGKQLITSGLAGVATIHAAHEVFENLEKRKARQKAVKSGQLSKGDARKLKTKALIKDATAVGIAALGIKGAFTSVKEAKELQHECKSFQLEKARRHERREKRRKRQEMGPRRRSGSLPAPRKQRLIDWEDDIPRYDDEHYTRRPAAPPLRHHAFKEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.05
4 0.05
5 0.05
6 0.05
7 0.06
8 0.07
9 0.07
10 0.08
11 0.13
12 0.16
13 0.18
14 0.25
15 0.26
16 0.29
17 0.37
18 0.43
19 0.48
20 0.53
21 0.6
22 0.64
23 0.71
24 0.76
25 0.72
26 0.72
27 0.7
28 0.66
29 0.59
30 0.53
31 0.5
32 0.48
33 0.47
34 0.43
35 0.43
36 0.42
37 0.44
38 0.47
39 0.48
40 0.47
41 0.51
42 0.5
43 0.43
44 0.44
45 0.39
46 0.32
47 0.25
48 0.2
49 0.11
50 0.09
51 0.08
52 0.03
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.08
62 0.1
63 0.11
64 0.12
65 0.13
66 0.14
67 0.22
68 0.24
69 0.25
70 0.29
71 0.29
72 0.29
73 0.32
74 0.35
75 0.28
76 0.29
77 0.35
78 0.35
79 0.41
80 0.5
81 0.57
82 0.59
83 0.66
84 0.72
85 0.73
86 0.77
87 0.82
88 0.84
89 0.85
90 0.91
91 0.93
92 0.89
93 0.88
94 0.88
95 0.88
96 0.88
97 0.87
98 0.81
99 0.74
100 0.71
101 0.62
102 0.57
103 0.56
104 0.54
105 0.53
106 0.54
107 0.59
108 0.6
109 0.62
110 0.58
111 0.53
112 0.51
113 0.48
114 0.46
115 0.41
116 0.44
117 0.44
118 0.43
119 0.39
120 0.33
121 0.28
122 0.25
123 0.22
124 0.21
125 0.23
126 0.29
127 0.32
128 0.36
129 0.38
130 0.4
131 0.41
132 0.46
133 0.51
134 0.52
135 0.56
136 0.59
137 0.65
138 0.65