Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2VNQ7

Protein Details
Accession A0A0A2VNQ7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
4-23SSKRTVTKTRRKTRDLDQVKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGISSKRTVTKTRRKTRDLDQVKADLASAKHLGHFKDTKAKEDLPGLGRNYCIRCAKWFDTNAALVAHVQGKPHKRRLKQLREETEIARLPGGRYIPPPCNAIEKPLREPQTGEDSNMTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.8
4 0.8
5 0.77
6 0.72
7 0.66
8 0.59
9 0.55
10 0.49
11 0.39
12 0.31
13 0.24
14 0.21
15 0.18
16 0.15
17 0.17
18 0.2
19 0.2
20 0.23
21 0.25
22 0.24
23 0.32
24 0.33
25 0.34
26 0.35
27 0.36
28 0.31
29 0.32
30 0.33
31 0.27
32 0.3
33 0.27
34 0.23
35 0.23
36 0.25
37 0.24
38 0.24
39 0.23
40 0.2
41 0.21
42 0.27
43 0.29
44 0.31
45 0.31
46 0.28
47 0.27
48 0.27
49 0.25
50 0.18
51 0.16
52 0.1
53 0.1
54 0.1
55 0.08
56 0.09
57 0.13
58 0.21
59 0.27
60 0.37
61 0.44
62 0.46
63 0.56
64 0.66
65 0.73
66 0.75
67 0.8
68 0.78
69 0.77
70 0.76
71 0.66
72 0.61
73 0.51
74 0.41
75 0.32
76 0.25
77 0.19
78 0.19
79 0.2
80 0.15
81 0.17
82 0.22
83 0.26
84 0.28
85 0.29
86 0.27
87 0.33
88 0.32
89 0.35
90 0.38
91 0.39
92 0.42
93 0.49
94 0.52
95 0.46
96 0.48
97 0.45
98 0.47
99 0.44
100 0.4