Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7E443

Protein Details
Accession A7E443    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKSKFKIGKKFRGPDRHVKCLSBasic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 5, nucl 4, extr 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
KEGG ssl:SS1G_00065  -  
Pfam View protein in Pfam  
PF00639  Rotamase  
PROSITE View protein in PROSITE  
PS50198  PPIC_PPIASE_2  
Amino Acid Sequences MKSKFKIGKKFRGPDRHVKCLSIEFGGALGWKGKGDLDPEFEKVAFEMEASTTTKPKYREGCGLDDGMKQIEGLNAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.81
4 0.72
5 0.64
6 0.57
7 0.49
8 0.44
9 0.34
10 0.26
11 0.16
12 0.14
13 0.13
14 0.11
15 0.08
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.08
23 0.09
24 0.13
25 0.14
26 0.15
27 0.16
28 0.15
29 0.14
30 0.12
31 0.12
32 0.08
33 0.06
34 0.05
35 0.05
36 0.07
37 0.08
38 0.09
39 0.11
40 0.12
41 0.16
42 0.18
43 0.25
44 0.29
45 0.32
46 0.4
47 0.43
48 0.46
49 0.45
50 0.46
51 0.4
52 0.36
53 0.33
54 0.25
55 0.21
56 0.16
57 0.14