Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086SX60

Protein Details
Accession A0A086SX60    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-36RADPPQPPDPKPKKPRQTDPPRPNPSLLHydrophilic
NLS Segment(s)
PositionSequence
6-24RKERADPPQPPDPKPKKPR
Subcellular Location(s) nucl 22.5, mito_nucl 13, mito 2.5
Family & Domain DBs
Amino Acid Sequences MTSEKRKERADPPQPPDPKPKKPRQTDPPRPNPSLLEPHEAIIAELKTKYNVLPASVISSTQIRQRVAAATGHLLSGANPVVLLHARPAEVCKLITIAEQSKRVLKEEGRPCFQYNQLFDLPPETKKPDIVEKTVLETDAHDSDDDDDFEVMETRFEKAVFPQTVRTMKSMRVFLSTMAIPEIKAKSNVTVQTSEVKVKKHGQGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.77
4 0.75
5 0.75
6 0.75
7 0.79
8 0.8
9 0.84
10 0.89
11 0.89
12 0.92
13 0.92
14 0.92
15 0.93
16 0.9
17 0.84
18 0.76
19 0.68
20 0.62
21 0.6
22 0.53
23 0.49
24 0.41
25 0.38
26 0.37
27 0.33
28 0.27
29 0.21
30 0.17
31 0.12
32 0.13
33 0.13
34 0.12
35 0.13
36 0.13
37 0.15
38 0.15
39 0.15
40 0.15
41 0.15
42 0.18
43 0.17
44 0.17
45 0.13
46 0.14
47 0.14
48 0.17
49 0.21
50 0.17
51 0.18
52 0.19
53 0.2
54 0.2
55 0.2
56 0.16
57 0.14
58 0.13
59 0.13
60 0.11
61 0.09
62 0.08
63 0.08
64 0.07
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.05
72 0.06
73 0.06
74 0.07
75 0.08
76 0.09
77 0.1
78 0.09
79 0.08
80 0.08
81 0.09
82 0.09
83 0.1
84 0.12
85 0.14
86 0.16
87 0.16
88 0.19
89 0.2
90 0.21
91 0.21
92 0.19
93 0.26
94 0.33
95 0.37
96 0.37
97 0.38
98 0.38
99 0.38
100 0.39
101 0.35
102 0.28
103 0.28
104 0.26
105 0.24
106 0.22
107 0.24
108 0.22
109 0.19
110 0.2
111 0.19
112 0.18
113 0.19
114 0.21
115 0.26
116 0.28
117 0.29
118 0.31
119 0.28
120 0.31
121 0.3
122 0.29
123 0.2
124 0.18
125 0.18
126 0.14
127 0.14
128 0.11
129 0.1
130 0.12
131 0.13
132 0.12
133 0.1
134 0.09
135 0.08
136 0.09
137 0.1
138 0.08
139 0.08
140 0.08
141 0.09
142 0.1
143 0.1
144 0.1
145 0.12
146 0.21
147 0.22
148 0.23
149 0.25
150 0.31
151 0.36
152 0.37
153 0.38
154 0.31
155 0.34
156 0.38
157 0.38
158 0.33
159 0.32
160 0.31
161 0.28
162 0.3
163 0.25
164 0.2
165 0.18
166 0.17
167 0.13
168 0.18
169 0.2
170 0.18
171 0.2
172 0.21
173 0.22
174 0.28
175 0.33
176 0.32
177 0.31
178 0.3
179 0.35
180 0.36
181 0.41
182 0.38
183 0.36
184 0.38
185 0.44
186 0.49