Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086SV62

Protein Details
Accession A0A086SV62    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPMLKEPWKKYKKFQPVNLPDRQWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito_nucl 13.833, cyto_nucl 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
Amino Acid Sequences MPMLKEPWKKYKKFQPVNLPDRQWPSKSLDKAPRWLATDLRDGNQSLPDPMASSPSNGSLGRYTTKEEKRNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.82
4 0.85
5 0.83
6 0.75
7 0.69
8 0.66
9 0.61
10 0.51
11 0.43
12 0.42
13 0.42
14 0.42
15 0.45
16 0.47
17 0.47
18 0.51
19 0.52
20 0.49
21 0.44
22 0.42
23 0.36
24 0.29
25 0.32
26 0.28
27 0.25
28 0.23
29 0.21
30 0.2
31 0.21
32 0.18
33 0.12
34 0.12
35 0.11
36 0.1
37 0.1
38 0.14
39 0.11
40 0.12
41 0.13
42 0.14
43 0.17
44 0.16
45 0.18
46 0.16
47 0.18
48 0.21
49 0.21
50 0.26
51 0.32
52 0.41