Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086TA03

Protein Details
Accession A0A086TA03   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
28-54MVSKLTSAQRRRERGRRSQAAFRKRQAHydrophilic
NLS Segment(s)
PositionSequence
37-52RRRERGRRSQAAFRKR
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSPNPDDPTIQVTTSPSPQHVVCPRWCMVSKLTSAQRRRERGRRSQAAFRKRQAQAAKDLEDENRRLKEAIQKLVSAAGGGAPHSELLASVNHLAEAAGIDKGPAQTLTPPATTTLGQAAPPQRLTFDMWLDPLHYARISLPPRDIVPYLGHGADTFAGRLFWSVLDHVQSGCHRGQHDQPAVLIQRSLTHSKAVQRVKPSFIQAMVEARLEYRNTGSISPRYMAAAEQDLSSVVSRRVKEDYRETGRDPSRWLTCLGVENRVRRMLGVEVFALLDRAVRGEGDTFLRNSMNNIKCRLYDSSVCFGDGPRWHVNVVDALFLGWMVNSWPSGNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.26
4 0.27
5 0.27
6 0.34
7 0.38
8 0.41
9 0.4
10 0.44
11 0.44
12 0.47
13 0.48
14 0.43
15 0.4
16 0.39
17 0.38
18 0.4
19 0.48
20 0.5
21 0.55
22 0.62
23 0.67
24 0.71
25 0.77
26 0.78
27 0.79
28 0.81
29 0.86
30 0.86
31 0.82
32 0.83
33 0.83
34 0.84
35 0.83
36 0.78
37 0.77
38 0.69
39 0.71
40 0.68
41 0.62
42 0.61
43 0.59
44 0.56
45 0.48
46 0.48
47 0.44
48 0.43
49 0.42
50 0.38
51 0.33
52 0.32
53 0.3
54 0.31
55 0.36
56 0.37
57 0.42
58 0.38
59 0.37
60 0.36
61 0.37
62 0.34
63 0.24
64 0.17
65 0.1
66 0.08
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.05
73 0.04
74 0.05
75 0.06
76 0.07
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.05
88 0.06
89 0.06
90 0.07
91 0.07
92 0.06
93 0.08
94 0.12
95 0.14
96 0.14
97 0.14
98 0.15
99 0.16
100 0.16
101 0.14
102 0.14
103 0.12
104 0.12
105 0.16
106 0.17
107 0.18
108 0.19
109 0.18
110 0.15
111 0.16
112 0.18
113 0.16
114 0.16
115 0.14
116 0.14
117 0.14
118 0.14
119 0.13
120 0.11
121 0.1
122 0.08
123 0.08
124 0.08
125 0.15
126 0.17
127 0.18
128 0.18
129 0.18
130 0.19
131 0.21
132 0.2
133 0.15
134 0.14
135 0.14
136 0.14
137 0.13
138 0.12
139 0.1
140 0.1
141 0.09
142 0.08
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.04
150 0.05
151 0.05
152 0.06
153 0.07
154 0.07
155 0.07
156 0.08
157 0.09
158 0.11
159 0.11
160 0.13
161 0.13
162 0.15
163 0.19
164 0.26
165 0.27
166 0.25
167 0.24
168 0.25
169 0.25
170 0.23
171 0.19
172 0.11
173 0.12
174 0.14
175 0.17
176 0.14
177 0.15
178 0.17
179 0.22
180 0.3
181 0.32
182 0.32
183 0.37
184 0.39
185 0.41
186 0.41
187 0.39
188 0.32
189 0.28
190 0.25
191 0.19
192 0.19
193 0.17
194 0.15
195 0.12
196 0.11
197 0.12
198 0.11
199 0.11
200 0.1
201 0.11
202 0.12
203 0.14
204 0.17
205 0.18
206 0.19
207 0.19
208 0.19
209 0.16
210 0.16
211 0.14
212 0.12
213 0.13
214 0.11
215 0.1
216 0.1
217 0.1
218 0.1
219 0.1
220 0.1
221 0.1
222 0.15
223 0.15
224 0.18
225 0.23
226 0.26
227 0.31
228 0.37
229 0.43
230 0.46
231 0.5
232 0.5
233 0.53
234 0.54
235 0.5
236 0.46
237 0.43
238 0.38
239 0.36
240 0.35
241 0.27
242 0.25
243 0.31
244 0.29
245 0.32
246 0.33
247 0.36
248 0.38
249 0.39
250 0.37
251 0.3
252 0.3
253 0.26
254 0.23
255 0.21
256 0.17
257 0.15
258 0.16
259 0.15
260 0.13
261 0.09
262 0.07
263 0.06
264 0.06
265 0.06
266 0.06
267 0.07
268 0.08
269 0.1
270 0.13
271 0.15
272 0.15
273 0.17
274 0.18
275 0.17
276 0.2
277 0.28
278 0.31
279 0.34
280 0.37
281 0.38
282 0.38
283 0.42
284 0.44
285 0.4
286 0.4
287 0.41
288 0.44
289 0.42
290 0.42
291 0.39
292 0.34
293 0.35
294 0.32
295 0.32
296 0.3
297 0.3
298 0.3
299 0.3
300 0.31
301 0.3
302 0.27
303 0.21
304 0.16
305 0.15
306 0.15
307 0.14
308 0.12
309 0.06
310 0.05
311 0.05
312 0.07
313 0.07