Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086T3J9

Protein Details
Accession A0A086T3J9   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIVKKRTKRFARHQSDRFKCVDPSWRKPKGIDSRVRRRFRGHydrophilic
NLS Segment(s)
PositionSequence
10-20IVKKRTKRFAR
34-45RKPKGIDSRVRR
Subcellular Location(s) mito 20.5, mito_nucl 12.833, nucl 4, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFARHQSDRFKCVDPSWRKPKGIDSRVRRRFRGTMVMPSIGFGSNKKTRFMMPSGHKAFLVSNVNDVELLLMHNRTYAAEIAHNVSSRKRIDIIARAKQLGVKVTNSKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.86
4 0.87
5 0.87
6 0.88
7 0.88
8 0.89
9 0.9
10 0.86
11 0.81
12 0.74
13 0.65
14 0.57
15 0.5
16 0.51
17 0.49
18 0.52
19 0.57
20 0.61
21 0.59
22 0.58
23 0.64
24 0.65
25 0.65
26 0.65
27 0.65
28 0.69
29 0.77
30 0.81
31 0.73
32 0.68
33 0.62
34 0.57
35 0.56
36 0.48
37 0.46
38 0.43
39 0.42
40 0.37
41 0.33
42 0.3
43 0.21
44 0.18
45 0.11
46 0.14
47 0.19
48 0.2
49 0.21
50 0.21
51 0.21
52 0.24
53 0.26
54 0.28
55 0.27
56 0.35
57 0.37
58 0.37
59 0.36
60 0.33
61 0.31
62 0.28
63 0.27
64 0.18
65 0.17
66 0.16
67 0.17
68 0.16
69 0.15
70 0.1
71 0.06
72 0.07
73 0.05
74 0.06
75 0.05
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.29
106 0.31
107 0.37
108 0.44
109 0.44
110 0.44
111 0.41