Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086T4P4

Protein Details
Accession A0A086T4P4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-102IGDRRRPTPRPNRRHTASPTBasic
NLS Segment(s)
PositionSequence
87-96RRPTPRPNRR
Subcellular Location(s) plas 10, golg 7, E.R. 4, extr 3, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNSTKPMYPLMRITDEVADGVSILHLCLALWVMLILLILFIFYLPPLLELDWQGLLLLRPYGDDQDPRRLPPRWQLAPPEGDIGDRRRPTPRPNRRHTASPTLLRRRSSITKTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.24
4 0.19
5 0.13
6 0.1
7 0.08
8 0.06
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.03
20 0.03
21 0.04
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.05
48 0.07
49 0.07
50 0.12
51 0.14
52 0.24
53 0.25
54 0.27
55 0.32
56 0.32
57 0.34
58 0.38
59 0.45
60 0.4
61 0.42
62 0.45
63 0.44
64 0.45
65 0.43
66 0.37
67 0.28
68 0.24
69 0.24
70 0.24
71 0.27
72 0.26
73 0.27
74 0.31
75 0.36
76 0.45
77 0.54
78 0.6
79 0.63
80 0.7
81 0.78
82 0.77
83 0.82
84 0.79
85 0.78
86 0.75
87 0.74
88 0.75
89 0.76
90 0.76
91 0.69
92 0.64
93 0.61
94 0.62