Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SWX6

Protein Details
Accession A0A086SWX6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-105IEELKQRGKSNPKKKRGPPATKLAPAHydrophilic
NLS Segment(s)
PositionSequence
85-110QRGKSNPKKKRGPPATKLAPAGGKKK
Subcellular Location(s) mito 16.5, cyto_mito 11, nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRARLLDLMKAQCHVFATTYNPEGVRMGNKVLRQRLRGPSLAAYYPRKVATIKDVKRIFGPHLTTWDDAEEDRFEYIEELKQRGKSNPKKKRGPPATKLAPAGGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.3
4 0.23
5 0.17
6 0.14
7 0.18
8 0.2
9 0.21
10 0.22
11 0.2
12 0.2
13 0.19
14 0.19
15 0.17
16 0.14
17 0.16
18 0.18
19 0.21
20 0.27
21 0.34
22 0.37
23 0.39
24 0.44
25 0.48
26 0.49
27 0.47
28 0.43
29 0.38
30 0.36
31 0.34
32 0.31
33 0.27
34 0.24
35 0.24
36 0.23
37 0.21
38 0.19
39 0.18
40 0.22
41 0.29
42 0.3
43 0.37
44 0.37
45 0.37
46 0.39
47 0.39
48 0.33
49 0.28
50 0.29
51 0.21
52 0.24
53 0.26
54 0.25
55 0.24
56 0.22
57 0.18
58 0.14
59 0.15
60 0.12
61 0.1
62 0.09
63 0.09
64 0.08
65 0.08
66 0.1
67 0.13
68 0.14
69 0.17
70 0.2
71 0.25
72 0.28
73 0.34
74 0.44
75 0.5
76 0.59
77 0.67
78 0.74
79 0.79
80 0.85
81 0.89
82 0.89
83 0.89
84 0.85
85 0.85
86 0.84
87 0.8
88 0.73
89 0.66
90 0.63