Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086T205

Protein Details
Accession A0A086T205   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MLNRPTYNRPPRKRTAPPDPRPIVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008145  GK/Ca_channel_bsu  
IPR008144  Guanylate_kin-like_dom  
IPR017665  Guanylate_kinase  
IPR020590  Guanylate_kinase_CS  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004385  F:guanylate kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF00625  Guanylate_kin  
PROSITE View protein in PROSITE  
PS00856  GUANYLATE_KINASE_1  
PS50052  GUANYLATE_KINASE_2  
CDD cd00071  GMPK  
Amino Acid Sequences MLNRPTYNRPPRKRTAPPDPRPIVISGPSGVGKGTLYTRLRENHPGCFAFSVSHTSRKPRAGEQHGVDYHYVSMEEFEDLIAKDSFIEHAKFGDNRYGTSKMTIEEQSKKGQVVLLDIEMEGVKQMKKSGIKARYIFIAPPSLEALEARLRGRGTENEESIQKRLAQAKNELEYSKTPGVHDIIILNDDLDTAYKQLEEFVYKAPEDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.87
4 0.86
5 0.88
6 0.82
7 0.74
8 0.66
9 0.58
10 0.5
11 0.41
12 0.34
13 0.24
14 0.23
15 0.21
16 0.19
17 0.16
18 0.13
19 0.11
20 0.1
21 0.11
22 0.17
23 0.18
24 0.2
25 0.25
26 0.29
27 0.33
28 0.42
29 0.43
30 0.41
31 0.45
32 0.43
33 0.4
34 0.37
35 0.33
36 0.23
37 0.22
38 0.23
39 0.2
40 0.26
41 0.26
42 0.31
43 0.36
44 0.4
45 0.42
46 0.42
47 0.5
48 0.5
49 0.55
50 0.52
51 0.55
52 0.51
53 0.49
54 0.42
55 0.33
56 0.26
57 0.19
58 0.16
59 0.07
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.06
66 0.06
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.09
74 0.1
75 0.08
76 0.09
77 0.11
78 0.12
79 0.13
80 0.17
81 0.15
82 0.15
83 0.19
84 0.2
85 0.19
86 0.19
87 0.19
88 0.14
89 0.17
90 0.18
91 0.18
92 0.21
93 0.23
94 0.24
95 0.24
96 0.24
97 0.21
98 0.2
99 0.16
100 0.13
101 0.12
102 0.09
103 0.09
104 0.08
105 0.08
106 0.07
107 0.06
108 0.05
109 0.05
110 0.05
111 0.06
112 0.07
113 0.11
114 0.13
115 0.19
116 0.28
117 0.32
118 0.39
119 0.4
120 0.4
121 0.39
122 0.38
123 0.33
124 0.26
125 0.25
126 0.18
127 0.18
128 0.17
129 0.14
130 0.13
131 0.13
132 0.14
133 0.12
134 0.14
135 0.13
136 0.15
137 0.15
138 0.15
139 0.19
140 0.2
141 0.24
142 0.28
143 0.3
144 0.29
145 0.33
146 0.35
147 0.33
148 0.31
149 0.25
150 0.24
151 0.3
152 0.32
153 0.33
154 0.38
155 0.43
156 0.45
157 0.47
158 0.43
159 0.37
160 0.35
161 0.37
162 0.35
163 0.29
164 0.26
165 0.26
166 0.27
167 0.25
168 0.24
169 0.18
170 0.15
171 0.15
172 0.14
173 0.11
174 0.09
175 0.08
176 0.08
177 0.08
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.1
184 0.12
185 0.14
186 0.15
187 0.19
188 0.22